BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L16 (852 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0942 + 22773678-22773777,22773869-22774022,22774194-227742... 31 0.88 02_04_0426 - 22802143-22802667,22804929-22805129 31 1.5 10_06_0164 + 11364436-11367280,11367357-11367715 29 3.6 12_01_0987 - 10016203-10017165,10017346-10018180,10019532-10020379 29 4.7 03_06_0726 - 35761959-35762063,35762232-35762336,35762543-357626... 29 4.7 01_05_0339 + 21135250-21135467,21136465-21137513,21137905-21138962 29 4.7 05_03_0617 - 16257281-16257943 28 8.2 >07_03_0942 + 22773678-22773777,22773869-22774022,22774194-22774265, 22774353-22774424,22774599-22774667,22774754-22774926, 22775457-22775629,22775654-22775827,22775987-22776113, 22776184-22776252,22776432-22776621,22776789-22776921, 22777091-22777441 Length = 618 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = -2 Query: 602 LKRVMPERVVRKMEFLXQGCG*HRPITGGMAERPVVGGLVGPTFACIIAQQF 447 L +P + +EF GC H P V+GG+ G + AC A F Sbjct: 141 LNNQLPHGLSISVEFSYGGCAYHSPPGASNQRIAVIGGVAGGSLACTFALGF 192 >02_04_0426 - 22802143-22802667,22804929-22805129 Length = 241 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 424 LSPFLKLPNCCAMMQANVGPTRPPTTGLSAIPPVIGLCHP 543 ++P L P+C A + + P PP T LS PP L P Sbjct: 26 VAPLLLPPSCQARLPTS-SPVMPPVTPLSPPPPCFALSRP 64 >10_06_0164 + 11364436-11367280,11367357-11367715 Length = 1067 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 319 VSKVRHRTCAKDILLICCSCAGVN 390 +SK+RHR ++ CCSC+G+N Sbjct: 811 ISKIRHRNLIG--VITCCSCSGLN 832 >12_01_0987 - 10016203-10017165,10017346-10018180,10019532-10020379 Length = 881 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 467 CIIAQQFGNLRKGDRFWYENGGFDSSFTPAQLQQIRRI 354 CI +QQF +L + +YE GG F + ++RR+ Sbjct: 766 CISSQQFQSLMEFRFIYYEGGGLRMLFQQEAMAKLRRL 803 >03_06_0726 - 35761959-35762063,35762232-35762336,35762543-35762665, 35763056-35763316,35763449-35763905,35764637-35764755, 35764851-35764919 Length = 412 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = -2 Query: 419 WYENGGFDSSFTPAQLQQIRRISFAQVLCRTLDTIETIQPFVFLSPQNPDNE 264 W + G D+ +T + R+I +V + D + P PQNP ++ Sbjct: 95 WTDGGKVDAKYTSRAAELYRQILQKEVAKSSADNVLPSSPVAASQPQNPSDD 146 >01_05_0339 + 21135250-21135467,21136465-21137513,21137905-21138962 Length = 774 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 518 GMAERPVVGGLVGPTFACI 462 G + +PVVG + GPT ACI Sbjct: 733 GASRKPVVGKISGPTIACI 751 >05_03_0617 - 16257281-16257943 Length = 220 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +1 Query: 403 PPFSYQNLSPFLKLPNCCAMMQANVGPTRPPTTGLSAIPPVIGLC 537 PPF LSP L P C + + P P + PP +G C Sbjct: 16 PPFF---LSPPLAAPRCSTALSPSSPPFHPTRLRIRWAPPPVGWC 57 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,916,901 Number of Sequences: 37544 Number of extensions: 421426 Number of successful extensions: 965 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 964 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2373961368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -