BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L16 (852 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 24 1.5 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 3.6 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 22 8.2 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 24.2 bits (50), Expect = 1.5 Identities = 8/34 (23%), Positives = 18/34 (52%) Frame = +3 Query: 528 RSMSSTSLXQEFHFPYNPLWHYSLQIVEAXNRCQ 629 + + ++ + ++ P NPL HY +E +C+ Sbjct: 171 KEIPNSIILDQYTNPGNPLAHYDQTAIEIWKQCE 204 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.0 bits (47), Expect = 3.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 212 STGISQSCSIVRFDMKSFHCQDFEGRGKQTVGSFRSCL 325 +TG+ +S S D + + QD+ + TV SF S L Sbjct: 353 TTGLERSRSWSSLDNTNTNDQDYSSQNYLTVHSFPSTL 390 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.8 bits (44), Expect = 8.2 Identities = 6/16 (37%), Positives = 13/16 (81%) Frame = -3 Query: 388 SLRRNYSRSEGYPSRK 341 +++++YS GYP+R+ Sbjct: 15 AIKKSYSIENGYPARR 30 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,956 Number of Sequences: 438 Number of extensions: 4235 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27431202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -