BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L15 (805 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4F6.18c |arf1||ADP-ribosylation factor Arf1|Schizosaccharomy... 89 7e-19 SPBC1539.08 |||ADP-ribosylation factor, Arf family|Schizosacchar... 58 2e-09 SPCC622.02 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual 28 1.8 SPBC2G2.01c |liz1|SPBC4B4.13c|pantothenate transporter |Schizosa... 27 2.4 SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr ... 25 9.5 >SPBC4F6.18c |arf1||ADP-ribosylation factor Arf1|Schizosaccharomyces pombe|chr 2|||Manual Length = 180 Score = 89.0 bits (211), Expect = 7e-19 Identities = 41/49 (83%), Positives = 41/49 (83%) Frame = -2 Query: 795 LLXFAXKQDLPNAMNXAEITDKLGXHSLRXRNWYIQATCATSGDGLXRG 649 LL FA KQDLPNAMN AEITDKLG HSLR R WYIQATCATSGDGL G Sbjct: 121 LLVFANKQDLPNAMNAAEITDKLGLHSLRHRQWYIQATCATSGDGLYEG 169 >SPBC1539.08 |||ADP-ribosylation factor, Arf family|Schizosaccharomyces pombe|chr 2|||Manual Length = 184 Score = 57.6 bits (133), Expect = 2e-09 Identities = 28/58 (48%), Positives = 36/58 (62%) Frame = -2 Query: 795 LLXFAXKQDLPNAMNXAEITDKLGXHSLRXRNWYIQATCATSGDGLXRGSRLALQSAQ 622 LL A KQDLP A++ A+ITD L L+ R W +Q TCA +GDGL G Q+A+ Sbjct: 125 LLVLANKQDLPGALSPAQITDVLQLDKLKDRLWNVQPTCALTGDGLLEGLAWLSQNAK 182 >SPCC622.02 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual Length = 127 Score = 27.9 bits (59), Expect = 1.8 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +2 Query: 650 PRYSPSPEVAHVAWMYQLRXRSECXPSL-SVISAXFIAFGKSCLXAXIK 793 P SP PEV+H W+ L P L S + IAF CL A I+ Sbjct: 16 PNSSPDPEVSHKLWVSSLNKFQYTLPLLISNFAGLGIAF-IYCLIAFIR 63 >SPBC2G2.01c |liz1|SPBC4B4.13c|pantothenate transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 514 Score = 27.5 bits (58), Expect = 2.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 413 LKYCFSKYYINYVYLNAINGMQINSVQ 333 L YC Y+INY+ ++IN ++ +Q Sbjct: 33 LSYCCVSYFINYLDRSSINNAYLSGMQ 59 >SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 962 Score = 25.4 bits (53), Expect = 9.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 208 LKKNKIVGNSPTLHTIFCSTSSRIEHA 288 LKK K N P L FCS S R E A Sbjct: 203 LKKAKKFPNFPKLKNFFCSYSHRHETA 229 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,908,571 Number of Sequences: 5004 Number of extensions: 57824 Number of successful extensions: 111 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 390427050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -