BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L14 (801 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 272 2e-73 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 272 2e-73 SB_56| Best HMM Match : Actin (HMM E-Value=0) 272 2e-73 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 272 2e-73 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 271 5e-73 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 270 7e-73 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 240 8e-64 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 85 6e-17 SB_54| Best HMM Match : Actin (HMM E-Value=0) 83 3e-16 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 69 4e-12 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 38 0.007 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 31 1.4 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.5 SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) 29 4.4 SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) 28 7.7 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 272 bits (668), Expect = 2e-73 Identities = 127/134 (94%), Positives = 131/134 (97%) Frame = -3 Query: 694 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 515 LPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSG Sbjct: 205 LPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSG 264 Query: 514 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMRISKQE 335 GTTMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM ISKQE Sbjct: 265 GTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 324 Query: 334 YDESGPSIVHRKCF 293 YDESGP+IVHRKCF Sbjct: 325 YDESGPAIVHRKCF 338 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -1 Query: 765 YVALDFEQEMATXASSSSLEKSYDFP 688 YVALDFEQEM T ASSSSLEKSY+ P Sbjct: 181 YVALDFEQEMQTAASSSSLEKSYELP 206 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 272 bits (668), Expect = 2e-73 Identities = 127/134 (94%), Positives = 131/134 (97%) Frame = -3 Query: 694 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 515 LPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSG Sbjct: 243 LPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSG 302 Query: 514 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMRISKQE 335 G+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM ISKQE Sbjct: 303 GSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 362 Query: 334 YDESGPSIVHRKCF 293 YDESGPSIVHRKCF Sbjct: 363 YDESGPSIVHRKCF 376 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -1 Query: 765 YVALDFEQEMATXASSSSLEKSYDFP 688 YVALDFEQEM T ASSSSLEKSY+ P Sbjct: 219 YVALDFEQEMETAASSSSLEKSYELP 244 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 272 bits (668), Expect = 2e-73 Identities = 127/134 (94%), Positives = 131/134 (97%) Frame = -3 Query: 694 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 515 LPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSG Sbjct: 242 LPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSG 301 Query: 514 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMRISKQE 335 G+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM ISKQE Sbjct: 302 GSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 361 Query: 334 YDESGPSIVHRKCF 293 YDESGPSIVHRKCF Sbjct: 362 YDESGPSIVHRKCF 375 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -1 Query: 765 YVALDFEQEMATXASSSSLEKSYDFP 688 YVALDFEQEM T ASSSSLEKSY+ P Sbjct: 218 YVALDFEQEMQTAASSSSLEKSYELP 243 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 272 bits (667), Expect = 2e-73 Identities = 127/134 (94%), Positives = 131/134 (97%) Frame = -3 Query: 694 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 515 LPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSG Sbjct: 243 LPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSG 302 Query: 514 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMRISKQE 335 G+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM ISKQE Sbjct: 303 GSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 362 Query: 334 YDESGPSIVHRKCF 293 YDESGPSIVHRKCF Sbjct: 363 YDESGPSIVHRKCF 376 Score = 48.0 bits (109), Expect = 9e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -1 Query: 765 YVALDFEQEMATXASSSSLEKSYDFP 688 YVALDFEQEM T ASSSSLEKSY+ P Sbjct: 219 YVALDFEQEMTTAASSSSLEKSYELP 244 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 271 bits (664), Expect = 5e-73 Identities = 126/134 (94%), Positives = 131/134 (97%) Frame = -3 Query: 694 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 515 LPDGQVITIGNERFRCPEAL QPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTV+SG Sbjct: 216 LPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANTVMSG 275 Query: 514 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMRISKQE 335 GTTMYPG+ADRMQKEI+ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM ISKQE Sbjct: 276 GTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 335 Query: 334 YDESGPSIVHRKCF 293 YDESGP+IVHRKCF Sbjct: 336 YDESGPAIVHRKCF 349 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -1 Query: 765 YVALDFEQEMATXASSSSLEKSYDFP 688 YVALDFEQEM T ASSSS+EKSY+ P Sbjct: 192 YVALDFEQEMQTAASSSSIEKSYELP 217 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 270 bits (663), Expect = 7e-73 Identities = 126/134 (94%), Positives = 131/134 (97%) Frame = -3 Query: 694 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 515 LPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSG Sbjct: 242 LPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSG 301 Query: 514 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMRISKQE 335 G+TM+PGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM ISKQE Sbjct: 302 GSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 361 Query: 334 YDESGPSIVHRKCF 293 YDESGPSIVHRKCF Sbjct: 362 YDESGPSIVHRKCF 375 Score = 48.4 bits (110), Expect = 7e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 765 YVALDFEQEMATXASSSSLEKSYDFP 688 YVALDFEQEMAT A+SSSLEKSY+ P Sbjct: 218 YVALDFEQEMATAAASSSLEKSYELP 243 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 240 bits (588), Expect = 8e-64 Identities = 110/134 (82%), Positives = 122/134 (91%) Frame = -3 Query: 694 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 515 LPDGQVI+IGNERFRCPEA+FQP+FLGMEA GIHE YN IMKCDVDIRKDLY+N VLSG Sbjct: 16 LPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDLYSNCVLSG 75 Query: 514 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMRISKQE 335 G+TM+PGIADRMQKEI LA ++MK+K+IAPPERKYSVWIGGSILASLSTFQQM I+K+E Sbjct: 76 GSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLSTFQQMWIAKEE 135 Query: 334 YDESGPSIVHRKCF 293 Y E GP IVHRKCF Sbjct: 136 YHEYGPPIVHRKCF 149 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 93.1 bits (221), Expect = 2e-19 Identities = 39/83 (46%), Positives = 55/83 (66%) Frame = -3 Query: 706 EVLRLPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 527 E LPDG+V+ + ERF PEALFQP + +E G+ E +N+I D+D R + Y + Sbjct: 242 EQYTLPDGRVVKLSGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHI 301 Query: 526 VLSGGTTMYPGIADRMQKEITAL 458 VLSGG+TMYPG+ R+++EI L Sbjct: 302 VLSGGSTMYPGLPSRLEREIKQL 324 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 85.0 bits (201), Expect = 6e-17 Identities = 50/149 (33%), Positives = 75/149 (50%), Gaps = 17/149 (11%) Frame = -3 Query: 676 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 500 + + ERF PE F P F + + E N I C +D+R+ LY N VLSGG+TM+ Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMF 255 Query: 499 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 368 R+Q++I + P ++ ++I+ ++Y+VW GGS+LAS Sbjct: 256 RDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQRYAVWFGGSMLASTP 315 Query: 367 TFQQMRISKQEYDESGPSIVHRKCF*THR 281 F + +K +YDE GPSI F HR Sbjct: 316 EFYSVCHTKADYDEHGPSICRHNPF-LHR 343 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 82.6 bits (195), Expect = 3e-16 Identities = 37/60 (61%), Positives = 45/60 (75%) Frame = -3 Query: 694 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 515 LPDGQ I IG+ERFR E LFQPS LG + GIHE+ + SI KCD+D+R +L+ N VLSG Sbjct: 2287 LPDGQSIRIGSERFRAAEPLFQPSLLGRDIDGIHESIFKSIKKCDIDLRAELFHNIVLSG 2346 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 68.9 bits (161), Expect = 4e-12 Identities = 30/85 (35%), Positives = 54/85 (63%), Gaps = 3/85 (3%) Frame = -3 Query: 616 GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI 437 G A G+ + S+ D+DIR L+ + +++GG T+ G +R+ +E+ + P +M++ Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRL 205 Query: 436 KII---APPERKYSVWIGGSILASL 371 K+I + E++++ WIGGSILASL Sbjct: 206 KLISNNSSVEKRFNPWIGGSILASL 230 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 53.2 bits (122), Expect = 2e-07 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 9/94 (9%) Frame = -3 Query: 580 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPS--------TMKIKIIA 425 +S++ C +D RK L N VL GGT M PG R+ +EI L S +K+ Sbjct: 64 DSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQ 123 Query: 424 PP-ERKYSVWIGGSILASLSTFQQMRISKQEYDE 326 PP + W+GG+I SL +++ Y + Sbjct: 124 PPVNANITAWLGGAIFGSLEVLADRSTTRERYQQ 157 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = -3 Query: 577 SIMKCDVDIRKDLYANTVLSGGTTMYPG 494 +I K D+D+R+ LY+N VLSGG+T++ G Sbjct: 264 AIQKSDLDLRRVLYSNIVLSGGSTLFKG 291 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 31.9 bits (69), Expect = 0.62 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 646 PEALFQPSFLGMEACGIHET 587 PE +FQPS LG+E GI ET Sbjct: 3 PEIIFQPSMLGLEQAGITET 22 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 Query: 694 LPDGQVITIGNERFRCPEALFQPSFL 617 LPDGQ+I+IG E E LF+P L Sbjct: 873 LPDGQMISIGYECISSMEPLFRPDLL 898 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +3 Query: 384 IDPPIHTEYFLSGGAMILIFIVDGARAVISFCIRSAIPGYMV-VPPD-NTVLAYKSLRMS 557 +DPP+ +Y L+GG ++ + FCI G++V PP+ N+ + R++ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCI---FQGFVVPTPPECNSAIVLPDARIT 814 Query: 558 TS 563 S Sbjct: 815 AS 816 >SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 158 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 678 SSPSETKDSVAQRLSSNPRSWVWK 607 S+ SETK SV +R + + W+W+ Sbjct: 96 STKSETKASVVERFNRTSKEWMWR 119 >SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 411 STPYGSVDRSSPPSLPSNKCGSRNKSTTSLAPPLYTGSAS 292 STP +V PP PSN+ + +K S +P T S S Sbjct: 217 STPQATVQTPPPPPEPSNEPSTSSKPKASPSPSSITTSTS 256 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = -1 Query: 369 LPSNKCGSRNKSTTSLAPPLYTGSASKRTARRCLQQP 259 L C SR K P Y G RT ++C +P Sbjct: 118 LVKRTCNSRKKKKPEKRPSSYNGDTDYRTRKQCRYEP 154 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 532 NTVLSGGTTMYPGIADRMQKEITALAP 452 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) Length = 1066 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -1 Query: 366 PSNKCGSRNKSTTSLAPPLYTGSASK--RTARRCLQQPAAGC 247 P N+ G++ + +L P++TGS + RT + P+A C Sbjct: 879 PGNQAGNKTRPLRALRSPIHTGSTLEVDRTRQGTRPDPSARC 920 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,041,003 Number of Sequences: 59808 Number of extensions: 513468 Number of successful extensions: 1518 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1515 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -