BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L14 (801 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 244 1e-66 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 25 0.82 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.9 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 4.4 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 7.6 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 7.6 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 244 bits (596), Expect = 1e-66 Identities = 115/117 (98%), Positives = 116/117 (99%) Frame = -3 Query: 694 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 515 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG Sbjct: 17 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 76 Query: 514 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMRIS 344 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPE+KYSVWIGGSILASLSTFQQM IS Sbjct: 77 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSILASLSTFQQMWIS 133 Score = 33.1 bits (72), Expect = 0.003 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 741 EMATXASSSSLEKSYDFP 688 EMAT ASSSSLEKSY+ P Sbjct: 1 EMATAASSSSLEKSYELP 18 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 25.0 bits (52), Expect = 0.82 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = -3 Query: 580 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 401 N +K D DI++ Y + V MYP + M+K I+ + KI I P E K + Sbjct: 342 NKELKYD-DIKEMEYLDKVFKETLRMYPPASILMRKAISDYTFNDTKITI--PKEMK--I 396 Query: 400 WI 395 WI Sbjct: 397 WI 398 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 1.9 Identities = 16/69 (23%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = -3 Query: 724 IQQLPREVL-RLPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIR 548 ++ LP+ + RL V+ + R + + + +FLG+ + +YN + D + Sbjct: 297 LRDLPKGIFTRLEQLLVLNLAGNRLGS-DRVDETTFLGLIRLIVLNLSYNMLTHIDARMF 355 Query: 547 KDLYANTVL 521 KDL+ +L Sbjct: 356 KDLFFLQIL 364 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 4.4 Identities = 12/51 (23%), Positives = 24/51 (47%) Frame = -1 Query: 786 GHXGEAGYVALDFEQEMATXASSSSLEKSYDFPTVRSSPSETKDSVAQRLS 634 G +AG + + + + + +++ +FP SS E +S+ QR S Sbjct: 73 GGIQQAGKPKEETDDKDDDESDNENIKSQKEFPNSSSSDDERPNSIHQRAS 123 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 527 RIVRWYHHVPWNRRPYAK 474 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 527 RIVRWYHHVPWNRRPYAK 474 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,858 Number of Sequences: 438 Number of extensions: 4699 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -