BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L13 (785 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 23 3.2 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 23 4.3 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 5.6 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 5.6 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 5.6 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 5.6 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 7.4 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 9.8 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 9.8 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 9.8 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 23.0 bits (47), Expect = 3.2 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +3 Query: 90 WLSTLRLPHPRLQRSPCRLLRNPSRGQPGPHGLRRTLPPPYPHRRTSARKHA 245 ++S R PHPRL+R P +P R PP+P R A A Sbjct: 160 YISQPRPPHPRLRRE-AEPEAEPGNNRPVYIPQPR---PPHPRLRREAEPEA 207 Score = 22.6 bits (46), Expect = 4.3 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +3 Query: 90 WLSTLRLPHPRLQRSPCRLLRNPSRGQPGPHGLRRTLPPPYPHRRTSARKHA 245 ++S R PHPRL+R P +P R PP+P R A A Sbjct: 104 YISQPRPPHPRLRRE-AEPEAEPGNNRPVYIPQPR---PPHPRLRREAELEA 151 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 22.6 bits (46), Expect = 4.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 105 RLPHPRLQRSP 137 R PHPRL+R P Sbjct: 110 RPPHPRLRREP 120 Score = 22.6 bits (46), Expect = 4.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 105 RLPHPRLQRSP 137 R PHPRL+R P Sbjct: 136 RPPHPRLRREP 146 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 Query: 315 LSNTTAIAEAWARLDHKFD 259 L+NT + W LD+ FD Sbjct: 32 LTNTLNVIHKWKYLDYDFD 50 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 403 NRFQGRYQLPA 371 NRF G Y++PA Sbjct: 435 NRFSGEYEIPA 445 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 442 QNQAYYPIRRLVSNRFQGRYQ 380 Q +A+Y +R +N FQ +YQ Sbjct: 17 QAKAHYSLRDFKANIFQVKYQ 37 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 498 MLYRGDVVPKDVNAAIAT 445 M+Y G V D+NA IAT Sbjct: 319 MMYLGTPVMPDLNALIAT 336 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 201 PPPYPHRRTSARKHAWRT 254 P P+P R T A+ H + T Sbjct: 417 PKPFPRRATLAQLHNFTT 434 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 629 AYVTSGKWIXGV 664 AY+ GKWI G+ Sbjct: 95 AYLLLGKWIFGI 106 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 629 AYVTSGKWIXGV 664 AY+ GKWI G+ Sbjct: 95 AYLLLGKWIFGI 106 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 629 AYVTSGKWIXGV 664 AY+ GKWI G+ Sbjct: 95 AYLLLGKWIFGI 106 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,681 Number of Sequences: 438 Number of extensions: 4921 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -