BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L11 (836 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 25 2.2 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 8.7 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 25.4 bits (53), Expect = 2.2 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +1 Query: 109 GVHGNIQTLYTLCNKNKMAQVSALNQRW*VSNFD 210 G G +Q +T+ +M ++S+ RW +FD Sbjct: 220 GRRGPLQAAFTIKELREMLKLSSCTTRWRADDFD 253 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 8.7 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = +3 Query: 252 SILDQPLQISDLALNEAWWNIKECIEQIVFVQIICHNREFSRAVC*KLESMSHP 413 +I + LQ L E W I E +QI N E +R S SHP Sbjct: 1000 AITPETLQFHLLQSQEKWSRIAEAAKQITSALQRDWNEERARLAVSSTLSPSHP 1053 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 701,668 Number of Sequences: 2352 Number of extensions: 13173 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88478514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -