BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L10 (845 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 27 0.95 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 23 8.8 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 26.6 bits (56), Expect = 0.95 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = -3 Query: 570 PHTVKRFPGY 541 PH+VKRFPGY Sbjct: 174 PHSVKRFPGY 183 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.4 bits (48), Expect = 8.8 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = -3 Query: 540 GLPFPKEPTRKGDLLVAFDIKFPERLTTGVKEILMDTL 427 G PF ++P + L+ F +FP T + + +T+ Sbjct: 644 GFPFDRQPVAQDHLMKDFVGRFPNMSRTVAEVMFTNTI 681 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 764,292 Number of Sequences: 2352 Number of extensions: 15287 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 89718867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -