BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L10 (845 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66513-5|CAA91334.1| 331|Caenorhabditis elegans Hypothetical pr... 54 1e-07 Z92834-5|CAB07390.1| 402|Caenorhabditis elegans Hypothetical pr... 42 4e-04 AF016428-7|AAB65361.1| 439|Caenorhabditis elegans Dnaj domain (... 35 0.084 Z47356-1|CAA87414.2| 82|Caenorhabditis elegans Hypothetical pr... 28 7.3 >Z66513-5|CAA91334.1| 331|Caenorhabditis elegans Hypothetical protein F54D5.8 protein. Length = 331 Score = 54.0 bits (124), Expect = 1e-07 Identities = 20/46 (43%), Positives = 32/46 (69%) Frame = -3 Query: 573 KPHTVKRFPGYGLPFPKEPTRKGDLLVAFDIKFPERLTTGVKEILM 436 KP T +R G GLP PK P+ +GDL++ FD++FP +L +E+++ Sbjct: 283 KPGTTRRLTGKGLPNPKSPSHRGDLIIEFDVEFPSQLNPTQREVIL 328 >Z92834-5|CAB07390.1| 402|Caenorhabditis elegans Hypothetical protein F39B2.10 protein. Length = 402 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = -3 Query: 561 VKRFPGYGLPFPKEPTRKGDLLVAFDIKFPERLTTGVKEILMDTLP 424 VK G+P + + KGDLLV FD+KFP+++ + L D LP Sbjct: 302 VKVIHNEGMPMRRASSDKGDLLVQFDVKFPDKINPDAAKKLADLLP 347 >AF016428-7|AAB65361.1| 439|Caenorhabditis elegans Dnaj domain (prokaryotic heat shockprotein) protein 19 protein. Length = 439 Score = 34.7 bits (76), Expect = 0.084 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 573 KPHTVKRFPGYGLPFPKEPTRKGDLLVAFDIKFPE 469 KP ++ G G+P K P KG+L V F+++FP+ Sbjct: 332 KPGVIRGVLGKGMPNKKYPELKGNLFVEFEVEFPK 366 >Z47356-1|CAA87414.2| 82|Caenorhabditis elegans Hypothetical protein T15H9.1 protein. Length = 82 Score = 28.3 bits (60), Expect = 7.3 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -3 Query: 540 GLPFPKEPTRKGDLLVAFDIKFPE 469 G+P ++ +KG L+V FD++FP+ Sbjct: 31 GMPSLEDNNKKGMLVVTFDVEFPK 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,662,962 Number of Sequences: 27780 Number of extensions: 330761 Number of successful extensions: 625 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2098003600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -