BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L08 (804 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9RWU0 Cluster: Preprotein translocase, SecA subunit; n... 35 2.8 >UniRef50_Q9RWU0 Cluster: Preprotein translocase, SecA subunit; n=2; Deinococcus|Rep: Preprotein translocase, SecA subunit - Deinococcus radiodurans Length = 877 Score = 34.7 bits (76), Expect = 2.8 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 2/73 (2%) Frame = +1 Query: 328 QLLPAMYLHICRKYLQLIVLNKHIHRHTRSSY*NARRTM*LTNY--TDPFTHYKTIGSNM 501 +L P M + R Y+ L V+++H H R+ + L Y DPFT YK +NM Sbjct: 796 ELSPTMMNSLAR-YVLLQVVDQHWKEHLHGMD-VLRQGIGLRGYGQRDPFTEYKFEATNM 853 Query: 502 IHNVLEALKCPVS 540 + +++ALK V+ Sbjct: 854 FNEMIDALKADVT 866 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,093,603 Number of Sequences: 1657284 Number of extensions: 12428941 Number of successful extensions: 21768 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 21036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21751 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 69143070360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -