BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L07 (782 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 29 0.032 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 29 0.032 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 3.6 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 4.8 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 29.5 bits (63), Expect = 0.032 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -2 Query: 679 VMAAPPPNYIQITIVSYKSQPAVPTRGPGPP 587 VM +PP N + +T+ Y+ P++ GP P Sbjct: 135 VMMSPPGNVLNLTMPKYEPNPSIIDPGPALP 165 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 29.5 bits (63), Expect = 0.032 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -2 Query: 679 VMAAPPPNYIQITIVSYKSQPAVPTRGPGPP 587 VM +PP N + +T+ Y+ P++ GP P Sbjct: 135 VMMSPPGNVLNLTMPKYEPNPSIIDPGPALP 165 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 3.6 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 107 CNIHLCPTNYMEIYCK 60 C + C Y+EI CK Sbjct: 774 CTVCTCDAKYLEIKCK 789 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 543 YNTLVLHFNCCLENV 499 Y +++ F+CCLE V Sbjct: 243 YQIILVIFDCCLETV 257 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,802 Number of Sequences: 336 Number of extensions: 3129 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -