BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L07 (782 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1477 + 37645143-37647425 29 4.2 10_08_0405 - 17657678-17658110,17658219-17659663,17659708-17660076 28 9.6 >01_06_1477 + 37645143-37647425 Length = 760 Score = 29.1 bits (62), Expect = 4.2 Identities = 22/65 (33%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Frame = -1 Query: 746 GRRESADAEQKEPAQDGX-TRTSRNGRASP*LYTNNYSIV*EPARSADPRARTALSLFVF 570 GRR A DG T TS SP + + AR PRAR A+ +F Sbjct: 197 GRRNITIAVNSPRDTDGHGTHTSSTAAGSPVPGASYFGYAPGVARGMAPRARVAVYKVLF 256 Query: 569 DYGKY 555 D G Y Sbjct: 257 DEGGY 261 >10_08_0405 - 17657678-17658110,17658219-17659663,17659708-17660076 Length = 748 Score = 27.9 bits (59), Expect = 9.6 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = -2 Query: 400 LL*LLTSIVIEIFVYFNLFFLISQSISKMKCSAPPPGRSVVVTLC*VKVMHLRKYLLSAQ 221 +L +LT I+IE + F +I +M CS P R + + V V+++R LLS+ Sbjct: 444 MLLVLTVILIEAHDFLTSFVFSDWNIVRMLCSYDRPSRRWLQKIYSV-VIYIRSCLLSSS 502 Query: 220 R 218 + Sbjct: 503 K 503 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,916,324 Number of Sequences: 37544 Number of extensions: 337324 Number of successful extensions: 745 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -