BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L06 (868 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 184 1e-46 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 163 1e-40 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 140 1e-33 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 112 3e-25 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 38 0.011 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 38 0.014 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 37 0.024 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 34 0.17 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 33 0.23 SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) 33 0.30 SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) 33 0.40 SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) 32 0.53 SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_35866| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.34) 32 0.53 SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.70 SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) 32 0.70 SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) 32 0.70 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.70 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 31 0.92 SB_54892| Best HMM Match : DHH (HMM E-Value=0.057) 31 0.92 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_40384| Best HMM Match : Filament (HMM E-Value=0.76) 31 1.2 SB_26151| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) 31 1.2 SB_35403| Best HMM Match : Lectin_C (HMM E-Value=1e-05) 31 1.2 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 31 1.2 SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) 31 1.2 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 31 1.2 SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) 31 1.6 SB_54719| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.045) 31 1.6 SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) 31 1.6 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 30 2.1 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 30 2.1 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 30 2.1 SB_24447| Best HMM Match : TolA (HMM E-Value=1.3) 30 2.1 SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) 30 2.1 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) 30 2.8 SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) 30 2.8 SB_21264| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_49603| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_54255| Best HMM Match : DUF329 (HMM E-Value=7.8) 29 3.7 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 29 3.7 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 4.4 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 29 4.9 SB_23579| Best HMM Match : PspA_IM30 (HMM E-Value=1.5) 29 4.9 SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_1024| Best HMM Match : Ank (HMM E-Value=0) 29 4.9 SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 29 4.9 SB_45735| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_37346| Best HMM Match : Extensin_2 (HMM E-Value=0.62) 29 4.9 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_20395| Best HMM Match : Extensin_2 (HMM E-Value=0.019) 29 4.9 SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) 29 6.5 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 29 6.5 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 29 6.5 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) 29 6.5 SB_129| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_47196| Best HMM Match : Extensin_2 (HMM E-Value=0.02) 29 6.5 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 29 6.5 SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_33744| Best HMM Match : SMC_N (HMM E-Value=0) 28 8.6 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) 28 8.6 SB_10066| Best HMM Match : GPS (HMM E-Value=8.6e-07) 28 8.6 SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_47339| Best HMM Match : Rubredoxin (HMM E-Value=0.76) 28 8.6 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 28 8.6 SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 184 bits (447), Expect = 1e-46 Identities = 82/129 (63%), Positives = 106/129 (82%) Frame = -2 Query: 564 KENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDE 385 KENKITITNDKGRLSKE+IERMVNEA KY+ ED+KQ++ IQ KN+LESY +SMKST+ED+ Sbjct: 499 KENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDD 558 Query: 384 KLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMXPGCRR 205 K+K+KIS+ DK+ ILDKC + +KWLD+NQ A+K+E+E+ QKELE + NPIITK+ Sbjct: 559 KVKDKISEEDKKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQQAGG 618 Query: 204 SPRRYAGLP 178 +P G+P Sbjct: 619 APPGAGGMP 627 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = -1 Query: 631 EVTFDIDANGILNVSAIEKST 569 EVTFDIDANGILNVSA++KST Sbjct: 477 EVTFDIDANGILNVSAVDKST 497 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 163 bits (397), Expect = 1e-40 Identities = 73/117 (62%), Positives = 96/117 (82%) Frame = -2 Query: 564 KENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDE 385 KENKITITNDKGRLSKE+IERMV EAEK++ D+ +E IQ+KN+LESY FSMKSTMEDE Sbjct: 591 KENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDE 650 Query: 384 KLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMXPG 214 K+K+K+S+ +++ ++ +C T+ WL+ NQ A+KEE + QKELEG+ NPIITK+ G Sbjct: 651 KVKDKLSEDEREKVISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQG 707 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/21 (76%), Positives = 21/21 (100%) Frame = -1 Query: 631 EVTFDIDANGILNVSAIEKST 569 +VTFD+D+NGILNVSA++KST Sbjct: 569 DVTFDVDSNGILNVSAVDKST 589 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 140 bits (339), Expect = 1e-33 Identities = 61/117 (52%), Positives = 88/117 (75%) Frame = -2 Query: 564 KENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDE 385 K ITITNDKGRLSKEEI+RM+N+AEKY++ED+ Q+E I A+N LESY F +KS + + Sbjct: 498 KTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEP 557 Query: 384 KLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMXPG 214 L+ K+S SDK T+ +K + + WL+ N LA+KEE+E ++KEL+ + +PI+ K+ G Sbjct: 558 SLEGKLSQSDKDTVKNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVHGG 614 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -1 Query: 631 EVTFDIDANGILNVSAIEKST 569 EVTFDIDANGILNVSA +KST Sbjct: 476 EVTFDIDANGILNVSAKDKST 496 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 112 bits (270), Expect = 3e-25 Identities = 51/109 (46%), Positives = 80/109 (73%), Gaps = 1/109 (0%) Frame = -2 Query: 561 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMED-E 385 + KITITND+ RL+ E+IERMVN+AEK+ +ED K KE ++A+N LESY +S+K+ + D E Sbjct: 1193 KEKITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKE 1252 Query: 384 KLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNP 238 KL K+S+ DK+TI + I W+D NQ A E+++ ++++ + +Y+P Sbjct: 1253 KLGGKLSEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKRKWKMLYSP 1301 Score = 34.7 bits (76), Expect = 0.099 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -1 Query: 631 EVTFDIDANGILNVSAIEKSTXQGEQ 554 EVTF+ID NGIL VSA +K T E+ Sbjct: 1170 EVTFEIDVNGILRVSAEDKGTGNKEK 1195 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 1/88 (1%) Frame = -2 Query: 561 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 382 E+K ++ K++ + E + DD + +AKNALES+ F ++ M E Sbjct: 679 ESKSEGKKEEPTADKDKKAEKADGKEAPKARDDAKAANERAKNALESHIFGVRDEMNSE- 737 Query: 381 LKEKIS-DSDKQTILDKCNDTIKWLDSN 301 L EK+S +++++TI + WLD + Sbjct: 738 LGEKLSTEAERETISEALTAASDWLDED 765 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -1 Query: 631 EVTFDIDANGILNVSAIEKSTXQGEQ 554 EVTFDIDANGI+NVSA +K T + +Q Sbjct: 281 EVTFDIDANGIVNVSARDKGTGREQQ 306 Score = 37.5 bits (83), Expect = 0.014 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 2/76 (2%) Frame = -2 Query: 564 KENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY--CFSMKSTME 391 +E +I I + G LSK+ IE M+ EAEKY E DKQK+ + K + + K Sbjct: 303 REQQIVIQSSGG-LSKDAIENMIKEAEKYA-EADKQKKVEKLKEEIAKVREVLANKDNET 360 Query: 390 DEKLKEKISDSDKQTI 343 E +++ S+ ++++ Sbjct: 361 GETIRQAYSELQQKSL 376 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 37.9 bits (84), Expect = 0.011 Identities = 25/98 (25%), Positives = 51/98 (52%), Gaps = 3/98 (3%) Frame = -2 Query: 507 ERMVNEAEKYRNEDD-KQKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQTILDK 334 ER A +Y D + + +A+ L++ S K T+ D +K + + D+ + Sbjct: 712 ERAREAATRYNKVDCIEYLDKAEAQFELKALITSTKETIADPDKHMGRFTKDDRVSGNRY 771 Query: 333 CNDTIKWLDSN-QLADKEEYEHKQKELEGIYNPIITKM 223 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 772 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 809 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 37.5 bits (83), Expect = 0.014 Identities = 30/115 (26%), Positives = 58/115 (50%), Gaps = 4/115 (3%) Frame = -2 Query: 585 LSRSPPXKENKITITNDKGRLSKEEIERMVNEAEKYRNED----DKQKETIQAKNALESY 418 L + KE K+ I +K K++ ER+ + EK + ++ K+KE + ++ L Sbjct: 931 LEKEKKEKEKKLLIEKEKREKEKQK-ERLREKEEKEKQKEAERAKKEKERLLQEDKLHEK 989 Query: 417 CFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 253 + E K++++ + DKQ +K D++K + + +DKE + K+KE E Sbjct: 990 EEKDRKDKEKRKVEKEKREKDKQVEKEK-KDSLKRVKKRKDSDKER-KVKEKEEE 1042 Score = 35.5 bits (78), Expect = 0.057 Identities = 26/103 (25%), Positives = 53/103 (51%), Gaps = 1/103 (0%) Frame = -2 Query: 564 KENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDE 385 KE K +K + K++ ER E ++ + + +K+K+ + K +E + + E Sbjct: 899 KEMKDKEKIEKEKREKDKREREEKERKRRQQQLEKEKKEKEKKLLIEKE--KREKEKQKE 956 Query: 384 KLKEKISDSDKQTILDKC-NDTIKWLDSNQLADKEEYEHKQKE 259 +L+EK + +KQ ++ + + L ++L +KEE + K KE Sbjct: 957 RLREK-EEKEKQKEAERAKKEKERLLQEDKLHEKEEKDRKDKE 998 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -3 Query: 548 PLPTTKVVSPRKRSSVWLMRQRSTETRMTSKRR 450 PLP T V R R WL + E+ TSK+R Sbjct: 297 PLPET-VAEERSRKGSWLRSLKKNESEKTSKKR 328 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 36.7 bits (81), Expect = 0.024 Identities = 23/91 (25%), Positives = 45/91 (49%) Frame = -2 Query: 519 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 340 K E+E+ E EK R E +KQ+ + K LES ++ + + EK + ++ ++ Sbjct: 105 KNEVEKERQEEEKRRMEIEKQRMESEKKRILESKQKRIEESKDTIHDNEKFLEEQRKRLV 164 Query: 339 DKCNDTIKWLDSNQLADKEEYEHKQKELEGI 247 +K + + + L D+ + E +Q EG+ Sbjct: 165 EKVKN--EGEEERMLHDQRQKEEEQWRKEGV 193 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 36.7 bits (81), Expect = 0.024 Identities = 29/109 (26%), Positives = 47/109 (43%) Frame = -2 Query: 585 LSRSPPXKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSM 406 LS+S + K T K EIE M EK R +++ ++ + + L + Sbjct: 1922 LSKSKNLENGKATEMVKKNEEKNNEIEEM---REKMRKANEEIEKILSKNSKLSDILNEL 1978 Query: 405 KSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 259 S +E+ +E +SDSD L K + + L+ KEE E +E Sbjct: 1979 NSGIENILNEETLSDSDPNVKLQKLREKFENLEKQVNNVKEEAEKNVQE 2027 Score = 35.5 bits (78), Expect = 0.057 Identities = 24/91 (26%), Positives = 52/91 (57%), Gaps = 1/91 (1%) Frame = -2 Query: 522 SKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSM-KSTMEDEKLKEKISDSDKQT 346 SKE+++ ++EA +D + ++A + ++ S+ + E E +KE + +++++ Sbjct: 1035 SKEKLQHRLDEA--LCKQDQYKNSLVEAVDEAKTLKESLYRMVNEHETMKESLLNANREI 1092 Query: 345 ILDKCNDTIKWLDSNQLADKEEYEHKQKELE 253 KC +T K LD+++ D+E+ E Q+E E Sbjct: 1093 GRLKCENTAKNLDADRKEDQED-EEVQREGE 1122 Score = 33.9 bits (74), Expect = 0.17 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 4/97 (4%) Frame = -2 Query: 534 KGRLSKEEIERMVNEAEKYRNE--DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 361 K +L KE+++ +VN + +E D+K K + K L+ + + K + +D Sbjct: 1630 KDKLLKEKVD-LVNSLHEKMSEMNDEKDKLDDENKQLLDEKSREVTDLKGEVKKAQDDAD 1688 Query: 360 SDKQTI--LDKCNDTIKWLDSNQLADKEEYEHKQKEL 256 S K+ + + + NDT+K + + LA +E+ EH EL Sbjct: 1689 SVKRLVDAIIEENDTLKQSEHDLLAIQEDLEHTIDEL 1725 Score = 30.3 bits (65), Expect = 2.1 Identities = 25/87 (28%), Positives = 44/87 (50%) Frame = -2 Query: 519 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 340 KEE E +V + + RN+ K+ E ++++ L K M+DE K + ++ +L Sbjct: 2543 KEEAEGLVEKLKVQRNQMIKEIEELKSEKGL----LEQKQQMQDEAQKLR----NEIEVL 2594 Query: 339 DKCNDTIKWLDSNQLADKEEYEHKQKE 259 K + I D+NQ ++KE K K+ Sbjct: 2595 KKLH-AIALEDANQKSEKELRREKMKK 2620 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 34.3 bits (75), Expect = 0.13 Identities = 32/102 (31%), Positives = 52/102 (50%), Gaps = 1/102 (0%) Frame = -2 Query: 558 NKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKL 379 +K+ + + L ++ +VNE +K + + D QK+ I+ + ES + ME EKL Sbjct: 1171 SKVAHSEEILALKAARLKELVNELDKMKKDLDAQKQAIEESRSEES---GIIGEME-EKL 1226 Query: 378 KEKISDSDKQTILD-KCNDTIKWLDSNQLADKEEYEHKQKEL 256 KE DK + L+ ND K L+ L+ KE E K +E+ Sbjct: 1227 KE---SKDKISKLEGTLNDKAKALEKAHLSLKEA-ETKLEEM 1264 >SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 33.9 bits (74), Expect = 0.17 Identities = 27/104 (25%), Positives = 51/104 (49%) Frame = -2 Query: 564 KENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDE 385 KENK DK ++ KE+ E M + + N++DK++ + K ++ M ++E Sbjct: 20 KENK----EDKEKMDKEDKEEM--DKQDKENKEDKEEMDKEDKEEMDQE--EMDKEDKEE 71 Query: 384 KLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 253 KE + D++ +DK + +D DKEE + ++ + E Sbjct: 72 MDKEDKEEMDQEE-MDKEEMDQEEMDKEDKEDKEEMDQEEMDKE 114 Score = 31.5 bits (68), Expect = 0.92 Identities = 23/92 (25%), Positives = 41/92 (44%) Frame = -2 Query: 534 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 355 KG + KE+ E M E +K + + KE K E + E++ +++ D Sbjct: 134 KGEMDKEDKEEMDQEMDKEEMDQEMDKE--MDKEDKEEMDQEEMDKQDKEEMDQEMDKQD 191 Query: 354 KQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 259 K+ +D+ + + D DKEE + + KE Sbjct: 192 KEE-MDQ--EEMDKQDKENKEDKEEMDKQDKE 220 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 33.9 bits (74), Expect = 0.17 Identities = 24/99 (24%), Positives = 47/99 (47%), Gaps = 4/99 (4%) Frame = -2 Query: 537 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQA-KNALES---YCFSMKSTMEDEKLKEK 370 DKG K++ E ++ E +++ + +KE Q+ K ES C S K E EK E+ Sbjct: 1526 DKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVEE 1585 Query: 369 ISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 253 D + + +++ D +K E + +++++E Sbjct: 1586 SKDENPEEKIEEKKDDTASEKKESSEEKMEVDGEEQKVE 1624 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 33.9 bits (74), Expect = 0.17 Identities = 24/99 (24%), Positives = 47/99 (47%), Gaps = 4/99 (4%) Frame = -2 Query: 537 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQA-KNALES---YCFSMKSTMEDEKLKEK 370 DKG K++ E ++ E +++ + +KE Q+ K ES C S K E EK E+ Sbjct: 105 DKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVEE 164 Query: 369 ISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 253 D + + +++ D +K E + +++++E Sbjct: 165 SKDENPEEKIEEKKDDTASEKKESSEEKMEVDGEEQKVE 203 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 33.5 bits (73), Expect = 0.23 Identities = 24/100 (24%), Positives = 50/100 (50%) Frame = -2 Query: 546 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKI 367 + +K RL EE+ER+ E +K E+ K++ET++ K L+ +E+E+ + + Sbjct: 277 LEEEKKRL--EELERLKEEKDKMLEEELKKRETLEEKQKLQD------KILEEERKRLEN 328 Query: 366 SDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGI 247 + ++Q + L + + A K+ E +K++ I Sbjct: 329 LEKERQAAQQAMQEAHDKLAAAEEAAKKASEEAKKKVREI 368 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 33.5 bits (73), Expect = 0.23 Identities = 30/104 (28%), Positives = 56/104 (53%), Gaps = 3/104 (2%) Frame = -2 Query: 549 TITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 370 T+ ND ++K+E+ER+ +K D+K+KE ++ K L+ TME ++L+ Sbjct: 3498 TVDND---ITKDELERL----KKIVENDEKEKENLKRK--LQG--SDSDGTMERKRLQRD 3546 Query: 369 ISDSDKQTILDKCNDTIKWL-DSNQLADKEEYE--HKQKELEGI 247 +SD+ + + + +K L D +LA K+ E K +E+E + Sbjct: 3547 MSDARAE--ISRLEKEVKRLKDDQELARKQRQEVIEKGREIEDL 3588 >SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) Length = 159 Score = 33.1 bits (72), Expect = 0.30 Identities = 21/93 (22%), Positives = 46/93 (49%) Frame = -2 Query: 537 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 358 +K +K+E E E ++ + + +K++E + + + ++ E E KEK + Sbjct: 20 EKEAETKKEAETEKEEEKETKKKTEKEEEKWKQEETEKEAETEKEAETEKEAEKEKKKKT 79 Query: 357 DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 259 +K+ K +T K ++ + A+ E+ E +KE Sbjct: 80 EKEEEKGKQEETGKEAETEKQAETEKQEETEKE 112 Score = 29.1 bits (62), Expect = 4.9 Identities = 22/80 (27%), Positives = 38/80 (47%) Frame = -2 Query: 492 EAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKW 313 E EK E +K+ ET + + + E +K EK + KQ +K +T K Sbjct: 6 ETEK-EGETEKEGETEKEAETKKEAETEKEEEKETKKKTEKEEEKWKQEETEKEAETEKE 64 Query: 312 LDSNQLADKEEYEHKQKELE 253 ++ + A+KE+ + +KE E Sbjct: 65 AETEKEAEKEKKKKTEKEEE 84 >SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 33.1 bits (72), Expect = 0.30 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 4/114 (3%) Frame = -2 Query: 582 SRSPPXKENKITITN---DKGRLSKEEIERMVNEAEKYRNED-DKQKETIQAKNALESYC 415 SRSP K + ++T D+GR S ER E +K R++D D+++E K+ Sbjct: 288 SRSPERKIKEDSVTKSDEDEGRSS----ERREKEEKKSRDKDKDRERERKDKKDRDRG-- 341 Query: 414 FSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 253 + +K ++K D DK+ +K + K D + DK+ K ++ E Sbjct: 342 --RNKDRDRDKERDKDRDRDKERDREKDRERDKDRDKERDRDKDREREKDRDKE 393 Score = 29.1 bits (62), Expect = 4.9 Identities = 21/93 (22%), Positives = 46/93 (49%), Gaps = 1/93 (1%) Frame = -2 Query: 537 DKGRLSKEEIERMVNEAEKYRNED-DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 361 DK R +E +R E ++ R++D DK+++ + + + + +K +++ D Sbjct: 353 DKDRDRDKERDR---EKDRERDKDRDKERDRDKDREREKDRDKERDRDKDRDKERDRDKD 409 Query: 360 SDKQTILDKCNDTIKWLDSNQLADKEEYEHKQK 262 DK+ D+ D K D ++ D++ + K+K Sbjct: 410 RDKERDRDRDRDRDKERDKDRHRDRDRRDRKEK 442 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 33.1 bits (72), Expect = 0.30 Identities = 29/99 (29%), Positives = 53/99 (53%), Gaps = 7/99 (7%) Frame = -2 Query: 522 SKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTI 343 S E+I +E + +N DK + + ++ E S K ++ +K ++ D +K+ Sbjct: 142 SSEKISEDEHEISQLKN--DKARCMQELRDEREK---SNKLVVDLQKTRKAQDDCEKE-- 194 Query: 342 LDKCNDTIKWLDSN------QLADK-EEYEHKQKELEGI 247 +++C TIK LDSN Q+AD+ EE + ++ELE + Sbjct: 195 VNRCEATIKTLDSNLKDLRQQVADRDEELNNNRQELESV 233 >SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) Length = 265 Score = 32.7 bits (71), Expect = 0.40 Identities = 24/99 (24%), Positives = 49/99 (49%) Frame = -2 Query: 537 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 358 +K R +EE +++ + +K+ ++ K+ E ++ KNA E++ LK K S+S Sbjct: 50 EKERKEREEEDKLWEDDDKHEQQEKKRLEALERKNAARQML-----EEEEKSLKGKTSNS 104 Query: 357 DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYN 241 + + + +LA ++E KQK+ E I++ Sbjct: 105 SAKMTRAQITE-----HQAKLAAEQEKLQKQKQQETIHD 138 >SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/72 (23%), Positives = 37/72 (51%) Frame = -2 Query: 585 LSRSPPXKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSM 406 L+ P K+ I +D G L ++ N+ +K + E+D+ +E + E++ SM Sbjct: 965 LTNDIPIPHYKVKIYDDDGDLKVSKLTGFFNDDDKEKEEEDRAEECEET----EAHIISM 1020 Query: 405 KSTMEDEKLKEK 370 + + D++ +E+ Sbjct: 1021 QEEVNDDETEEE 1032 >SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) Length = 552 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = -2 Query: 486 EKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 316 E+ D QKE QA +E Y S++ E KE + S+K+ + ++C + IK Sbjct: 13 EESTRAGDLQKEVTQASENIEKYSQSIRDLGE----KENVLTSEKKQLEEECQENIK 65 >SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/89 (20%), Positives = 46/89 (51%) Frame = -2 Query: 519 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 340 K+E++ + E+ + ++QK+ +Q + E K +++E+ K+++ + KQ + Sbjct: 88 KQEVQEEQKQEEQEEQKQEEQKQEVQEEQKQEEQ-EEQKQEVQEEQ-KQEVQEEQKQEVQ 145 Query: 339 DKCNDTIKWLDSNQLADKEEYEHKQKELE 253 ++ ++ + +E+ E KQ+E E Sbjct: 146 EEQKQEVQ----EEQKQEEQEEQKQEEQE 170 >SB_35866| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.34) Length = 758 Score = 32.3 bits (70), Expect = 0.53 Identities = 25/106 (23%), Positives = 46/106 (43%), Gaps = 3/106 (2%) Frame = -2 Query: 561 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTM---E 391 EN + + D + I +M + + E+ + + + AK E F ++ M E Sbjct: 346 ENLLKVEEDFDEAESDIILQMRTQLDMLAQENFRLQNELDAKRNYEEEYFELRQRMQEAE 405 Query: 390 DEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 253 DE K + K D ++ I+ L+ L + EYE + +EL+ Sbjct: 406 DEMASMKHEYATKTGESDFLSERIELLEKEILDMRVEYEGQIRELQ 451 >SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 699 Score = 31.9 bits (69), Expect = 0.70 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = -2 Query: 408 MKSTMEDEKLKEKISDSDKQTILDKCNDTIKW-LDSNQLADKEEYEHKQKELEGIYNPII 232 +++ + EK K + D +++ L + T+K+ LD +LA KE++ +KE EG + Sbjct: 100 VENDRDSEKHKRDLRDKEQE--LSELRKTVKYALDQEKLA-KEQFGDLKKEFEGYKKKMD 156 Query: 231 TKM 223 TKM Sbjct: 157 TKM 159 >SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) Length = 685 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/72 (23%), Positives = 36/72 (50%) Frame = -2 Query: 585 LSRSPPXKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSM 406 L+ P K+ I +D G L ++ N+ +K E+D+ +E + E++ SM Sbjct: 438 LTNDIPIPHYKVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISM 493 Query: 405 KSTMEDEKLKEK 370 + + D++ +E+ Sbjct: 494 QEEVNDDETEEE 505 >SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) Length = 232 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/72 (23%), Positives = 36/72 (50%) Frame = -2 Query: 585 LSRSPPXKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSM 406 L+ P K+ I +D G L ++ N+ +K E+D+ +E + E++ SM Sbjct: 77 LTNDIPIPHYKVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISM 132 Query: 405 KSTMEDEKLKEK 370 + + D++ +E+ Sbjct: 133 QEEVNDDETEEE 144 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 31.9 bits (69), Expect = 0.70 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 1/78 (1%) Frame = -2 Query: 495 NEAEKYRN-EDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTI 319 N EK +N E K K + + A E S++ ++ E+ EK ++T D+ N TI Sbjct: 1658 NNHEKEQNIESIKDKLWAEFEEAKED---SVREALDSER--EKWRKEYEKTTQDEINKTI 1712 Query: 318 KWLDSNQLADKEEYEHKQ 265 +L+ EE++HK+ Sbjct: 1713 SYLEDQYTRGLEEFKHKE 1730 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 31.5 bits (68), Expect = 0.92 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -2 Query: 558 NKITITNDKGRLSKEEIERMVNEAE-KYRNEDDKQKETIQAKNALESYCFSMKSTMED 388 NKI + N+ + SKE++ER V AE + R+ D + K +++LE S +++D Sbjct: 1038 NKILVENENLKGSKEDLERRVVVAENRLRDTDSEMKGWRDIRSSLERDLQSRDHSIDD 1095 >SB_54892| Best HMM Match : DHH (HMM E-Value=0.057) Length = 384 Score = 31.5 bits (68), Expect = 0.92 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 2/90 (2%) Frame = -2 Query: 579 RSPPXKENKITITNDKGRLSKEEIERMVNEAEKYRNED-DKQKETIQAKNALESYCFSMK 403 R P ++ + DK + + EE+ VNEA K E KQ++T Q+ + + C Sbjct: 142 RMTPKDQHIVQALQDKVKFNLEELYHSVNEATKRNTEAIQKQRQTRQSPASPGTICRLYN 201 Query: 402 STMEDEKLKEKISDSDKQTI-LDKCNDTIK 316 ++ E+ S++ K + +D TIK Sbjct: 202 KKLDFEQFDYGFSETIKGLLCVDVSAVTIK 231 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.5 bits (68), Expect = 0.92 Identities = 25/101 (24%), Positives = 51/101 (50%), Gaps = 3/101 (2%) Frame = -2 Query: 546 ITNDKGRLSKEEIER--MVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 373 ITN G++ KEE +R V E++K K++E I+ K A + E++++KE Sbjct: 1145 ITNAMGKIEKEEAKRKAAVEESQKAIEAARKKQEEIRQKQAA-----WRQQEEEEQRVKE 1199 Query: 372 KISD-SDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 253 ++ +++ ++ N L + + + E K+K++E Sbjct: 1200 RLQILREERERIEALNKEADLLIQRRKEAERKAEEKRKQIE 1240 >SB_40384| Best HMM Match : Filament (HMM E-Value=0.76) Length = 563 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/94 (24%), Positives = 39/94 (41%) Frame = -2 Query: 537 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 358 DK RL KE + R+ A ++R +KQ + E+ + + +K E I + Sbjct: 195 DKDRLKKEMVLRLNQVAAEFRKVSNKQMAETTKRTIRENVSINAQLAKMSDKTMELIQE- 253 Query: 357 DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKEL 256 ND ++ + Q + EH +KEL Sbjct: 254 ---------NDELRAKEKKQKLQIDMLEHNEKEL 278 >SB_26151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/58 (22%), Positives = 30/58 (51%) Frame = -2 Query: 561 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMED 388 EN++ K KEE+ + E+++ +K K+ ++ KN L+ +++ +E+ Sbjct: 180 ENEVASLKLKQETIKEEVVEEIEGDEEFQKLQNKYKQVVEEKNTLQGELDGLQTQLEE 237 >SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 333 CNDTIKWLDSN-QLADKEEYEHKQKELEGIYNPIITKM 223 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 7 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 44 >SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) Length = 348 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = -2 Query: 555 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN-ALESYCFSMKSTMEDEK 382 ++T D G + EE++R+ NE EK +NE + K+ L++Y + E EK Sbjct: 126 QLTSKADYGNIHAEELQRIRNELEKCKNEISDLNSKLNTKSQKLKTYKKHIGELQEREK 184 >SB_35403| Best HMM Match : Lectin_C (HMM E-Value=1e-05) Length = 2293 Score = 31.1 bits (67), Expect = 1.2 Identities = 28/114 (24%), Positives = 53/114 (46%), Gaps = 7/114 (6%) Frame = -2 Query: 579 RSPPXKENKITITNDKGRLSKEEIERM--VNEAEKYRNEDDKQKETIQAKNALESYCFSM 406 RS K+ + + D + S ++ E+ VN+ E R+ DDK+K K+ Sbjct: 377 RSRDDKKERPVVNRDDSQSSIDDKEKRPDVNKDESQRSRDDKEKRPDINKD-------DS 429 Query: 405 KSTMEDEKLKEKISDSDKQTILD---KCNDTIKWLDSN--QLADKEEYEHKQKE 259 + + +D++ + ++ D Q+ +D K D K + +A K+ Y +K KE Sbjct: 430 QRSRDDKEKRPDVNKDDSQSSIDDKEKRPDVNKQKNEKYMNVASKDHYMNKDKE 483 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 31.1 bits (67), Expect = 1.2 Identities = 26/101 (25%), Positives = 46/101 (45%) Frame = -2 Query: 519 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 340 K+E ER+ +AEK + K+KE ++ K E K E+EK K+ ++ I Sbjct: 349 KKEQERLEKQAEK----EKKEKERLEKKQREEKDRLEKKEKKEEEKRKK------EEEIN 398 Query: 339 DKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMXP 217 K + K + + ++E+ + K++ N IT P Sbjct: 399 AKIEEKKKREEKKKQEEEEKMKKKEQAKNNFVNFFITAPAP 439 >SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) Length = 364 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = -2 Query: 555 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN-ALESYCFSMKSTMEDEK 382 ++T D G + EE++R+ NE EK +NE + K+ L++Y + E EK Sbjct: 126 QLTSKADYGNIHAEELQRIRNELEKCKNEISDLNSKLNTKSQKLKTYKKHIGELQEREK 184 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/62 (27%), Positives = 32/62 (51%) Frame = -2 Query: 519 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 340 K E+E+ E EK R E +KQ+ + K LES ++ + + EK + ++ ++ Sbjct: 223 KNEVEKERQEEEKRRMEIEKQRMESEKKRILESKQKRIEESKDTIHDNEKFLEEQRKRLV 282 Query: 339 DK 334 +K Sbjct: 283 EK 284 >SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) Length = 200 Score = 30.7 bits (66), Expect = 1.6 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 1/106 (0%) Frame = -2 Query: 543 TNDKGRLSKE-EIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKI 367 +N K R SK+ ++ VN K D+K + KN + + +E+E I Sbjct: 4 SNSKARKSKQMTLQSKVNNQIKADRPDEKADRQTKKKNGFSLWLEENRDQIEEEN--PDI 61 Query: 366 SDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIIT 229 D D I K T K LDS + ++ Y+ L ++P++T Sbjct: 62 PDEDVVKIAMK---TWKGLDSVEKKLEKCYDDTLASLLNNHDPLVT 104 >SB_54719| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.045) Length = 782 Score = 30.7 bits (66), Expect = 1.6 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 8/77 (10%) Frame = -2 Query: 456 KETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILD------KCNDTIKWL--DSN 301 KE +Q + L ++ + K +E EK+ IS +D + +L+ K + I+ L + + Sbjct: 299 KERLQIERKLANFTKTSKKEVESEKV---ISRTDGKKVLELEKDISKKKNEIRRLRTELS 355 Query: 300 QLADKEEYEHKQKELEG 250 QL + +++H +KELEG Sbjct: 356 QLQENSKHKHFEKELEG 372 >SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) Length = 422 Score = 30.7 bits (66), Expect = 1.6 Identities = 24/107 (22%), Positives = 47/107 (43%), Gaps = 1/107 (0%) Frame = -2 Query: 570 PXKENKITITNDKGRLSKEEIERMVNE-AEKYRNEDDKQKETIQAKNALESYCFSMKSTM 394 P ++N + + D GR S E R AE + K + + + LE + Sbjct: 70 PERDNDVCVLRDNGRKSPEVPARPRQSLAELLEHPTKKDPSSTENHSLLEEKDIP-RDKK 128 Query: 393 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 253 D++LKE+ + +K+ + + K + +KE+ + K++E E Sbjct: 129 SDKELKEEKKEKEKERMKKEEKHKEKTRKEEKEREKEKEKTKKEEKE 175 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/72 (27%), Positives = 33/72 (45%) Frame = -2 Query: 564 KENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDE 385 KE K ++ +EE ER E K E+ KQ+E + K E + E+E Sbjct: 433 KERKKREAEEEEERRREEEERREEEERKREEEERKQREEEEKKREEEE-----RKQREEE 487 Query: 384 KLKEKISDSDKQ 349 + K+K + +K+ Sbjct: 488 ERKQKEKEEEKK 499 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 30.3 bits (65), Expect = 2.1 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 1/96 (1%) Frame = -2 Query: 537 DKGRLSKEEIERMVNEAEKYRNEDDKQK-ETIQAKNALESYCFSMKSTMEDEKLKEKISD 361 ++ R E R EAE+ R E +K+K E +A+ + + ++E+LK + D Sbjct: 179 EEARKKAEAKARFEQEAERRRREAEKRKAEEEEARRKADELEKIKRQQEDEERLKNQRLD 238 Query: 360 SDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 253 +++ K + L + KEE E K++E E Sbjct: 239 EERK----KLEEEEANLMEEERKRKEEAEKKREEEE 270 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 30.3 bits (65), Expect = 2.1 Identities = 25/109 (22%), Positives = 55/109 (50%), Gaps = 5/109 (4%) Frame = -2 Query: 564 KENKITITNDKGRLSKEE---IERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTM 394 +E + T ++ R ++EE I R EAE+ R E +++++ + +ALE C + Sbjct: 501 EEKRRKETEERERQAREEEDRIRREREEAERLRREKEQREQLVPHSDALE--CAIKPLNL 558 Query: 393 EDEKLK-EKISDSDKQTILDKCNDTIK-WLDSNQLADKEEYEHKQKELE 253 + ++K +K+ + ++ + +K + +L +K + E Q+E E Sbjct: 559 LEARIKAQKLEEEQRELERLQAEAELKRKQELERLREKRKEEKAQRERE 607 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/62 (29%), Positives = 35/62 (56%) Frame = -2 Query: 537 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 358 ++ + KEE ER+ EAE+ R ED++Q+ + + A E +K M+ K + + ++ Sbjct: 411 EEEKRQKEEEERLRVEAERQREEDERQRAEDERQRA-EDERQRVKHEMQRLKDERRRAEE 469 Query: 357 DK 352 D+ Sbjct: 470 DE 471 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = -2 Query: 519 KEEIERMVNEAEKYRNEDDK-QKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQ 349 KE+I+ NEA++ + DK +KE +KN LES +K+ ++ +E I+ ++Q Sbjct: 2 KEDIQVRSNEAQREARKKDKLEKELKTSKNDLESKTAELKTKQSQLQRNQEDIAKLEQQ 60 >SB_24447| Best HMM Match : TolA (HMM E-Value=1.3) Length = 325 Score = 30.3 bits (65), Expect = 2.1 Identities = 28/115 (24%), Positives = 61/115 (53%), Gaps = 11/115 (9%) Frame = -2 Query: 564 KENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY--------CFS 409 K+ +I N + ++ KE+ +M+ ++ K RN+ + + ++N L++Y S Sbjct: 76 KQLEINKLNRELKVLKEDYAKMIVKSYKSRNDQSRVMFVLSSQNFLQAYKRIQYMKQYAS 135 Query: 408 MKSTMEDE--KLKEKISDSD-KQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 253 + DE + ++K++++ KQ + K + K L+ N+ A+K E E ++K+ E Sbjct: 136 FRKMQGDEIAEKQDKLAEAKIKQEVSKKSKE--KALEENK-AEKIELESQKKDQE 187 >SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) Length = 803 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = -2 Query: 537 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 358 D+ + + I+R+ N + Y+ E D +E + E Y S++ + KL+++I D Sbjct: 560 DEIKFKTKTIDRLENRLQSYQVEIDDLQEEFERDR--EDYLDSIRKQEQTIKLQQQIIDK 617 Query: 357 DKQTILDKCN 328 + I CN Sbjct: 618 IQPCIRRDCN 627 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 30.3 bits (65), Expect = 2.1 Identities = 28/101 (27%), Positives = 44/101 (43%) Frame = -2 Query: 537 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 358 DK +L KEE E+ + E NE KQKE +A++ L++ + D K E D+ Sbjct: 1606 DKYQLEKEEAEKRLQSYEDELNEKQKQKE--KAEDNLKALKKRISDLEVDNKNLETARDN 1663 Query: 357 DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPI 235 D N ++ KEE E +L+ + N + Sbjct: 1664 AVYE-RDIANQKFVEQRTDNEVLKEEKEKLLMQLKDLQNEV 1703 >SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) Length = 1007 Score = 29.9 bits (64), Expect = 2.8 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = -2 Query: 519 KEEIERMVNEAEKYRNEDDKQKETIQAKNA-LESYCFSMKSTMEDEKLKEKISDSDKQTI 343 + E+E+ E EK DK+K+ ++ N L S+ S + DE KE +D+ Q I Sbjct: 837 RSELEKAKGEIEKAWTLYDKEKDRLEKLNGQLIDELKSLTSVL-DEMKKESENDAQCQKI 895 Query: 342 LD 337 LD Sbjct: 896 LD 897 >SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) Length = 271 Score = 29.9 bits (64), Expect = 2.8 Identities = 24/98 (24%), Positives = 48/98 (48%), Gaps = 1/98 (1%) Frame = -2 Query: 543 TNDKGRLSKE-EIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKI 367 T + + KE + E+ ++ + E + Q E +A+ E+ T E E +EK Sbjct: 144 TEKEAQTEKEAQTEKEAGTEKEAQTEKEAQMEK-EAETEKEAQTEKEAQT-EKEAEREKE 201 Query: 366 SDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 253 ++++K+ +K +T K + + A+ ++ KQKE E Sbjct: 202 AETEKEAKTEKEAETEKEAQTEKEAETQKEAEKQKEAE 239 >SB_21264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 29.9 bits (64), Expect = 2.8 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 2/95 (2%) Frame = -2 Query: 537 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 358 DK + KE+ E M E +K D + KE + + + M +E+ KE++ Sbjct: 21 DKEEMDKEDKEDM-EEMDK-EEMDQQDKEEMDQEEMDKKDKEDMDQEDMEEQDKEEMEQK 78 Query: 357 DKQTILDKCNDTIKWLDSNQL--ADKEEYEHKQKE 259 DK+ + ++ + + D + DKEE + + KE Sbjct: 79 DKEDMDEQDKEDMDKQDKEDMDKQDKEEMDKQDKE 113 >SB_49603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 29.5 bits (63), Expect = 3.7 Identities = 28/117 (23%), Positives = 48/117 (41%), Gaps = 5/117 (4%) Frame = -2 Query: 561 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK-QKETI---QAKNALESYCFSM-KST 397 + K + DKG K ++E EKY E+DK KE + K E Y K Sbjct: 73 KEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDKGN 132 Query: 396 MEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITK 226 E L+E + +K + + + K+ +KE++ + K ++ P+ K Sbjct: 133 KEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKFINISKAIKYFKPPLSYK 189 Score = 28.3 bits (60), Expect = 8.6 Identities = 25/96 (26%), Positives = 40/96 (41%), Gaps = 5/96 (5%) Frame = -2 Query: 546 ITNDKGRLSKEEIERMVNEAEKYRNEDDK-QKETI---QAKNALESYCFSM-KSTMEDEK 382 + DKG K ++E EKY E+DK KE + K E Y K E Sbjct: 66 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYD 125 Query: 381 LKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYE 274 L+E + +K + + + K+ +KE+Y+ Sbjct: 126 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYD 161 >SB_54255| Best HMM Match : DUF329 (HMM E-Value=7.8) Length = 82 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -2 Query: 405 KSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKEL 256 K T ED++ ++K ++SD Q + N T K +L + +E K+ EL Sbjct: 33 KVTQEDQEPEKKSNESDPQKDQETDNKTSKKESQEELREADETPKKKDEL 82 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -1 Query: 166 PEPEVPPPGLEALAPPSRRSIKP-TFHTTLKPTCNNHLVTSP 44 P+P+ PPPG PPS + P T +P VT P Sbjct: 28 PKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQP 69 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 23.8 bits (49), Expect(2) = 4.4 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -1 Query: 217 RVPEESPEVCRASRAEHPEPEVPPPGLEALAPPS 116 R PE+ EV S + P L+ L PPS Sbjct: 28 RFPEDDLEVSSVSASASSSTSRPTNALQPLKPPS 61 Score = 23.8 bits (49), Expect(2) = 4.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -1 Query: 130 LAPPSRRSIKPTFHTTLKPTCNNH 59 L PPSR+S P HT P+C ++ Sbjct: 80 LTPPSRQSNNPRPHT--PPSCQSN 101 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 29.1 bits (62), Expect = 4.9 Identities = 24/116 (20%), Positives = 50/116 (43%), Gaps = 4/116 (3%) Frame = -2 Query: 564 KENKITITNDKGRLSKEEIE----RMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKST 397 K+ KI ++ R +E++E R E K + E++++K +Q + K Sbjct: 588 KQQKIAEEQERLRKIQEQMELERKRREEEERKRKQEEEERKRKMQMELQRRKEEEEQKKR 647 Query: 396 MEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIIT 229 E+E+ + + + D+Q L+K + + D+E + + +NP T Sbjct: 648 DEEERKRREKEEKDRQFQLEKQRLAEEEQKRQAMIDQERRDRELAMRLANWNPFDT 703 Score = 28.7 bits (61), Expect = 6.5 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 3/94 (3%) Frame = -2 Query: 534 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQ-AKNALESYCFSMKSTMEDEKLKEKISDS 358 K R + +++ + A + + DK + IQ +NA +S +KSTM +K K+ D Sbjct: 512 KIRRLEVQVDNLAQLASSLKKDKDKVSKQIQDLRNATQSAIKKIKSTM----MKRKMIDE 567 Query: 357 DKQTILDKCNDTIKWLDSNQLADK--EEYEHKQK 262 ++ + N + L+ Q K EE E +K Sbjct: 568 VYCDLVKRVNHHLADLNERQKQQKIAEEQERLRK 601 >SB_23579| Best HMM Match : PspA_IM30 (HMM E-Value=1.5) Length = 207 Score = 29.1 bits (62), Expect = 4.9 Identities = 21/108 (19%), Positives = 45/108 (41%) Frame = -2 Query: 555 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 376 K+ D+ +I +MVN + +D + E + ++ K M+ L Sbjct: 9 KLQRLQDRELNDMSKIVQMVNNTARVTRKDARDTEA----SCVDVSLSVRKKNMDILHLN 64 Query: 375 EKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPII 232 +++ +K +D+ L+ + E EHK +ELE ++ ++ Sbjct: 65 DEVKRYEKLLAMDRKLPRRSILEERLGRAEAELEHKDRELENLHKQVV 112 >SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 29.1 bits (62), Expect = 4.9 Identities = 24/109 (22%), Positives = 50/109 (45%), Gaps = 1/109 (0%) Frame = -2 Query: 573 PPXKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTM 394 PP E N K + + ++IE + +K E+++ +E + ++ Sbjct: 611 PPDDEQVDEDNNIKNKTTAKKIEEPLPRTKKPEKEEEESEEESEEES------------- 657 Query: 393 EDEKLKEKIS-DSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEG 250 E+E+ EK++ D+ K +K ND++ + ++ E E ++ E EG Sbjct: 658 EEEEETEKVNKDALKAKATEKSNDSLCLSEEESEEEESEEESEEDEEEG 706 >SB_1024| Best HMM Match : Ank (HMM E-Value=0) Length = 891 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -1 Query: 211 PEESP--EVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPT 95 PE+ P EV A R E P+ E PP +PP ++ KPT Sbjct: 771 PEQPPIGEVESAVRREQPKSEKTPPSTTP-SPPPKQPSKPT 810 >SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1037 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -2 Query: 543 TNDKGRLSKEEIERMVNEAEKY-RNEDDKQKETIQAKNALE 424 TND G S +E E VN ++K NE++ + E ++ +N++E Sbjct: 888 TNDNGS-STDEAESEVNNSDKEGENEENDEVEDMEVENSIE 927 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 29.1 bits (62), Expect = 4.9 Identities = 24/102 (23%), Positives = 45/102 (44%), Gaps = 11/102 (10%) Frame = -2 Query: 534 KGRLSKEEIERMVNEAEKYRNED------DKQKETIQAKNALESYCFSMKSTMEDEKL-- 379 K +++ E +++AE + NED D E A E ++ E E++ Sbjct: 1408 KEEMAEIEKASQIDQAEDFPNEDEVPAVIDLLPENSSAFGISEEKIDGIQEAKESEEIVS 1467 Query: 378 ---KEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQK 262 E+I D D ++D ++ L ++ D+EE E ++K Sbjct: 1468 SGETEEIEDEDTPVVVDILSEDTSALGISEERDEEEIEQQKK 1509 >SB_45735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 484 Score = 29.1 bits (62), Expect = 4.9 Identities = 27/119 (22%), Positives = 49/119 (41%), Gaps = 2/119 (1%) Frame = -2 Query: 576 SPPXKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKST 397 SP K K + ++ ++V EA + +++ +K + ALE Y + + Sbjct: 260 SPEEAYRKFDDMATKQTETLRKLTKLVQEARQNHDDESVKKAVNEYDEALERYIPVLMAQ 319 Query: 396 MEDEKLKEKISDSDK--QTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITK 226 + E + +K + ++ CN+ W N E+K KE G Y PI+ K Sbjct: 320 AKIYWDLENYAQVEKIFRKSVEFCNEHEVW-KLNVAHVLFMQENKYKEAVGFYEPIVKK 377 >SB_37346| Best HMM Match : Extensin_2 (HMM E-Value=0.62) Length = 331 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 605 RYPQRFRYREVHQXRRTRSPLPTTKVVSPR 516 RYP+ R ++ R RSP+ +T+ SPR Sbjct: 51 RYPRGHRKSQIPPWTRARSPVDSTRAKSPR 80 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = -1 Query: 202 SPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPTCNNHLVTS 47 S + C A+ P + L+ P S S +PT TL CNN TS Sbjct: 417 SEQYCYFGDAKVPATFMNDTTLKCTVPTSSVSSRPTVAVTLNGGCNNFTTTS 468 >SB_20395| Best HMM Match : Extensin_2 (HMM E-Value=0.019) Length = 348 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 605 RYPQRFRYREVHQXRRTRSPLPTTKVVSPR 516 RYP+ R ++ R RSP+ +T+ SPR Sbjct: 208 RYPRGHRKSQIPPWTRARSPVDSTRAKSPR 237 >SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) Length = 440 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -1 Query: 253 RHLQSDNYEDVXRVPEESPEVCRASRA-EHPEPEVPPPGLEALAPPSRRS 107 + L+S + +D + E P V + R E +P PPP APP ++ Sbjct: 320 QRLESKDTKDDEPMEIEPPNVTKPDRTTEQTQPSPPPPETVTTAPPLHKT 369 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 28.7 bits (61), Expect = 6.5 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = -2 Query: 477 RNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQ 298 +N E + + + SY K + EK KEK + +K+ ILD K++ N Sbjct: 1081 KNSQTPLLEILSPRKDIGSYKSCPKLRKKREKEKEKDKEKEKEVILD-FEALDKFIGRNP 1139 Query: 297 LADKEEY-EHKQKELEGI 247 + E+ E + ELE I Sbjct: 1140 MTQIAEFREAEAAELEAI 1157 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 28.7 bits (61), Expect = 6.5 Identities = 20/54 (37%), Positives = 25/54 (46%) Frame = -3 Query: 605 RYPQRFRYREVHQXRRTRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTSKRRPS 444 R P + R +R+RSP + SPRKRS R RS R S R+ S Sbjct: 185 RSPSGRKSRSRSPRKRSRSPRKMLR--SPRKRSRTPRKRSRSPRKRSRSPRKGS 236 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/66 (27%), Positives = 34/66 (51%) Frame = -2 Query: 561 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 382 +NK T + + K+E R+ +EAEK E++K K+ + + + Y ++ + K Sbjct: 454 QNKDAATRYRVK-KKDEQSRLFDEAEKLEKENNKLKDEVGSLSKEIEYLKNLMLEVYQTK 512 Query: 381 LKEKIS 364 K+K S Sbjct: 513 QKQKES 518 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/55 (23%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = -2 Query: 393 EDEKLKEKISDSDK-QTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPII 232 ++E L++++S+ ++ Q ++++ N+T+K L +K+E K L+ +N ++ Sbjct: 31 DNESLQKRVSELEEHQKVIEETNETLKKQHETVLFEKDELTLTIKTLQEEFNTML 85 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = -2 Query: 528 RLSKEEIERMVNEAEKYRNED--DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 355 + K+E ER E EK R ++ ++KE + + E K E ++ KEK+ + + Sbjct: 316 KAKKKEKERQEREKEKEREKERIQQEKEKQKERREKEKQKHQEKKEKERQREKEKL-EKE 374 Query: 354 KQTILDK 334 KQ L++ Sbjct: 375 KQKELER 381 >SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) Length = 315 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/57 (26%), Positives = 31/57 (54%) Frame = -2 Query: 534 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS 364 K ++ K+++++ E ++ DDK KET+ N +ES + E++ E++S Sbjct: 229 KKQIEKQKLQQDEIEQGLLQDSDDKDKETL-GDNCIESNDMEESAKDSSEEISEELS 284 >SB_129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -2 Query: 576 SPPXKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 460 SP ENK IT+D G + +I+ V + ++Y N D+K Sbjct: 84 SPESPENKFAITHDHGCSNFGKIDASVGDDDEY-NGDEK 121 >SB_47196| Best HMM Match : Extensin_2 (HMM E-Value=0.02) Length = 376 Score = 28.7 bits (61), Expect = 6.5 Identities = 21/71 (29%), Positives = 29/71 (40%) Frame = -3 Query: 605 RYPQRFRYREVHQXRRTRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTSKRRPSRPRMHW 426 RYP+ R ++ R RSP+ + K SPR QR ++ T R RP + Sbjct: 73 RYPRGHRKSQIPPGTRARSPVDSAKARSPR--------GQRQSKNLRTIPHRGQRPNLSP 124 Query: 425 NLTASA*SLPW 393 A PW Sbjct: 125 PWIAPEPVPPW 135 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 28.7 bits (61), Expect = 6.5 Identities = 21/85 (24%), Positives = 47/85 (55%) Frame = -2 Query: 519 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 340 KEE + E EK + ED+ ++E + +E+ +K +EDE K+++ + +K+T Sbjct: 642 KEEERKRREEEEKKKREDEVKREEEGRRQKVEA---ELK-LIEDEH-KQRLEELEKKTKK 696 Query: 339 DKCNDTIKWLDSNQLADKEEYEHKQ 265 ++ + +++++ D+ + E KQ Sbjct: 697 EEEKKRSEHVNNDEELDRLQEEIKQ 721 >SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 942 Score = 28.7 bits (61), Expect = 6.5 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 7/70 (10%) Frame = -2 Query: 405 KSTMEDEKLKEKISDSDK-------QTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGI 247 K T + EK KEKI +K QT+LDK + + + +L K ++HK+ E Sbjct: 837 KGTEKQEKEKEKIQKEEKEPEKSKVQTLLDKLHRQARVEEEVKLVLKVYFKHKEITKEE- 895 Query: 246 YNPIITKMXP 217 Y I+ + P Sbjct: 896 YKSILRRAVP 905 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 28.3 bits (60), Expect = 8.6 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 6/92 (6%) Frame = -2 Query: 519 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS-----D 355 + +E +NE EK D + Q KN E C + +T E +K +++S+S + Sbjct: 805 RAHLESDINEKEKEIERKDNALKEFQEKNK-ELEC-QLAATGELKKTVDELSNSITLRDE 862 Query: 354 KQT-ILDKCNDTIKWLDSNQLADKEEYEHKQK 262 K T I ++ T++ + A KEE K+K Sbjct: 863 KITKIKEQLKQTLEKFKEKEKALKEEIAEKEK 894 >SB_33744| Best HMM Match : SMC_N (HMM E-Value=0) Length = 1014 Score = 28.3 bits (60), Expect = 8.6 Identities = 24/93 (25%), Positives = 42/93 (45%) Frame = -2 Query: 525 LSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQT 346 L EEI+ + N ++ + +K KETI A D +LK K + + ++ Sbjct: 561 LQLEEIKTLENNLDEQQQLIEKSKETIALATA----------KCNDIELKMKEAKTYRER 610 Query: 345 ILDKCNDTIKWLDSNQLADKEEYEHKQKELEGI 247 L K + +K +E + KQ+E+EG+ Sbjct: 611 ELKKAEEDLKKAKKRAEQSIKETKTKQQEVEGM 643 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -1 Query: 190 CRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPT 71 C A A+ P+ +VPPP APP + P TT PT Sbjct: 92 CNAKPAQ-PDTDVPPPPATTSAPPPPTTTAPP-ATTSPPT 129 >SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) Length = 888 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/62 (22%), Positives = 33/62 (53%) Frame = -2 Query: 555 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 376 ++ I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ + Sbjct: 618 EVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETE 673 Query: 375 EK 370 E+ Sbjct: 674 EE 675 >SB_10066| Best HMM Match : GPS (HMM E-Value=8.6e-07) Length = 1146 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = -1 Query: 202 SPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPTCNNHLVTSP 44 S + C A+ P + L+ P S S +PT TL CNN TSP Sbjct: 84 SEQYCYFGDAKVPATFMNDTTLKCTVPTSSVSSRPTVAVTLNGGCNN-FTTSP 135 >SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 28.3 bits (60), Expect = 8.6 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 6/86 (6%) Frame = -2 Query: 519 KEEIERM--VNEAEKYRN-EDDKQKETIQAK--NALESYCFSMKSTMEDEKLKEKISDSD 355 KEEIE NE E+ EDD +KE I+ + + + + E+E+++E+ D D Sbjct: 157 KEEIEEREDANEKEEIEEREDDNEKEEIEEREDDNEKEEIDEREDDNEEEEIEEREDDDD 216 Query: 354 KQTILDKC-NDTIKWLDSNQLADKEE 280 + D+ ND + + ++ D + Sbjct: 217 EVEERDETENDNDEGEEREEMEDDND 242 >SB_47339| Best HMM Match : Rubredoxin (HMM E-Value=0.76) Length = 730 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = -1 Query: 322 HQVAGFQPAGRQGGV*-AQAERIGRHLQSDNYEDVXRVPEESPEVCRASRAEHPEPEVPP 146 H+V +P GR G V + +R R L D+ + + P VC + + VPP Sbjct: 328 HRVVKSRPDGRGGTVQWSYCQRFRRCLDCGKVLDLHKAEPDKPHVCGEYKCRTCDDVVPP 387 Query: 145 PGL 137 L Sbjct: 388 DHL 390 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 8.6 Identities = 21/93 (22%), Positives = 48/93 (51%), Gaps = 1/93 (1%) Frame = -2 Query: 534 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 355 K + K++ ++ N+ K +K+K+ ++ K E+ + T+E E +EKI +++ Sbjct: 26 KKKKKKKKKKKKKNKKNKKNKNKNKKKKKMKKKKEEEAEVG--EKTLEAENEEEKIEETE 83 Query: 354 KQ-TILDKCNDTIKWLDSNQLADKEEYEHKQKE 259 K+ +K + K + ++EE E +++E Sbjct: 84 KEKDEEEKIEEEEKEGGEEENEEEEEEETEEEE 116 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = -2 Query: 516 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 352 EE+E + + E+ R+ + Q ET++ +N E K T E++ LKE I+ ++ Sbjct: 54 EELEDRIAKLEEERDNLEVQLETVRKENDTE----MEKQTNENDTLKETITGHEE 104 >SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -2 Query: 393 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 259 EDE+ E SD D +T +++ +D ++ D+EE HK +E Sbjct: 118 EDEEKTESESDDDDKTEKYSDDESDVSMDGDESDDEEEGPHKPEE 162 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,542,772 Number of Sequences: 59808 Number of extensions: 410576 Number of successful extensions: 2338 Number of sequences better than 10.0: 87 Number of HSP's better than 10.0 without gapping: 1961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2298 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2479240863 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -