BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L01 (1093 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 55 3e-06 UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b... 55 4e-06 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 54 9e-06 UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 52 2e-05 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 51 5e-05 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 51 5e-05 UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyosteli... 50 8e-05 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 50 1e-04 UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|... 50 1e-04 UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re... 49 2e-04 UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelle... 49 2e-04 UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 49 2e-04 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 49 2e-04 UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 48 3e-04 UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, wh... 48 3e-04 UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, wh... 48 3e-04 UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eut... 48 4e-04 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 48 6e-04 UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella ve... 47 7e-04 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 47 7e-04 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 46 0.001 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 46 0.001 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 46 0.002 UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; ... 46 0.002 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 46 0.002 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 46 0.002 UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2... 46 0.002 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 46 0.002 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 46 0.002 UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Enta... 45 0.003 UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella ve... 45 0.003 UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; ... 45 0.003 UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whol... 45 0.004 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 45 0.004 UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n... 44 0.005 UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyosteli... 44 0.005 UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cere... 44 0.005 UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|R... 44 0.007 UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.2... 44 0.007 UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; ... 44 0.007 UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Dia... 44 0.007 UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces cap... 44 0.007 UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa... 44 0.009 UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyosteli... 44 0.009 UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: F... 44 0.009 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 44 0.009 UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pomb... 44 0.009 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 43 0.012 UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; ... 43 0.012 UniRef50_Q6ML35 Cluster: Putative uncharacterized protein; n=1; ... 43 0.016 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 43 0.016 UniRef50_Q54ER5 Cluster: Formin homology domain-containing prote... 43 0.016 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 43 0.016 UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; ... 43 0.016 UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoe... 42 0.021 UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ... 42 0.021 UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12;... 42 0.021 UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms... 42 0.021 UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh... 42 0.021 UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14;... 42 0.021 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 42 0.021 UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; ... 42 0.028 UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n... 42 0.028 UniRef50_Q9VFZ6 Cluster: CG11670-PA; n=2; Sophophora|Rep: CG1167... 42 0.028 UniRef50_O01864 Cluster: Putative uncharacterized protein; n=2; ... 42 0.028 UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Eut... 42 0.028 UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis tha... 42 0.037 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 42 0.037 UniRef50_A2F9Y4 Cluster: Putative uncharacterized protein; n=1; ... 42 0.037 UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ... 41 0.049 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 41 0.049 UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep:... 41 0.049 UniRef50_UPI0000D8C71D Cluster: Wiskott-Aldrich syndrome protein... 41 0.064 UniRef50_Q23248 Cluster: Putative uncharacterized protein grl-21... 41 0.064 UniRef50_Q0KI93 Cluster: CG12946-PB, isoform B; n=4; Sophophora|... 41 0.064 UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing pro... 41 0.064 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 41 0.064 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 41 0.064 UniRef50_A4R9P2 Cluster: Predicted protein; n=1; Magnaporthe gri... 41 0.064 UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Pr... 41 0.064 UniRef50_UPI0000ECC7D2 Cluster: melanoma inhibitory activity fam... 40 0.085 UniRef50_Q640S7 Cluster: Fmnl1 protein; n=3; Xenopus|Rep: Fmnl1 ... 40 0.085 UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Re... 40 0.085 UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; ... 40 0.085 UniRef50_Q9W384 Cluster: CG7055-PA; n=4; Endopterygota|Rep: CG70... 40 0.085 UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; ... 40 0.085 UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; ... 40 0.085 UniRef50_Q6P0D5 Cluster: WW domain-binding protein 11; n=7; Eute... 40 0.085 UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein... 40 0.085 UniRef50_Q92945 Cluster: Far upstream element-binding protein 2;... 40 0.085 UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 ... 40 0.11 UniRef50_UPI0000E49E39 Cluster: PREDICTED: similar to Wiskott-Al... 40 0.11 UniRef50_UPI0000E4922C Cluster: PREDICTED: similar to Enabled ho... 40 0.11 UniRef50_Q61QV1 Cluster: Putative uncharacterized protein CBG068... 40 0.11 UniRef50_A7SHT8 Cluster: Predicted protein; n=2; Nematostella ve... 40 0.11 UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, wh... 40 0.11 UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, wh... 40 0.11 UniRef50_A0CRC9 Cluster: Chromosome undetermined scaffold_25, wh... 40 0.11 UniRef50_Q96WL0 Cluster: TPR-containing protein Mql1; n=4; Dikar... 40 0.11 UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cere... 40 0.11 UniRef50_Q6C0S3 Cluster: Yarrowia lipolytica chromosome F of str... 40 0.11 UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; ... 40 0.11 UniRef50_UPI00015B41F1 Cluster: PREDICTED: similar to ENSANGP000... 40 0.15 UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein ca... 40 0.15 UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH30... 40 0.15 UniRef50_A6G120 Cluster: Putative periplasmic protein TonB; n=1;... 40 0.15 UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; ... 40 0.15 UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23... 40 0.15 UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; ... 40 0.15 UniRef50_O28253 Cluster: Putative uncharacterized protein; n=1; ... 40 0.15 UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family... 40 0.15 UniRef50_A0JLT2 Cluster: Mediator of RNA polymerase II transcrip... 40 0.15 UniRef50_UPI0000DC00CB Cluster: SH3 domain binding protein CR16;... 39 0.20 UniRef50_Q20IN6 Cluster: HrpW; n=1; Pseudomonas cichorii|Rep: Hr... 39 0.20 UniRef50_A0FSR5 Cluster: SH3, type 3; n=1; Burkholderia phymatum... 39 0.20 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 39 0.20 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 39 0.20 UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-... 39 0.20 UniRef50_A5DSH8 Cluster: Putative uncharacterized protein; n=1; ... 39 0.20 UniRef50_P28702 Cluster: Retinoic acid receptor RXR-beta; n=240;... 39 0.20 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 39 0.26 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 39 0.26 UniRef50_A5UTQ5 Cluster: Putative uncharacterized protein; n=2; ... 39 0.26 UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabido... 39 0.26 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 39 0.26 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 39 0.26 UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG214... 39 0.26 UniRef50_Q5CVD5 Cluster: Putative uncharacterized protein; n=2; ... 39 0.26 UniRef50_A2F4E1 Cluster: Putative uncharacterized protein; n=1; ... 39 0.26 UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing pro... 39 0.26 UniRef50_Q7S7S6 Cluster: Putative uncharacterized protein NCU042... 39 0.26 UniRef50_A6RYT2 Cluster: Predicted protein; n=1; Botryotinia fuc... 39 0.26 UniRef50_A3LN86 Cluster: Protein involved in actin organization ... 39 0.26 UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2... 39 0.26 UniRef50_P22357 Cluster: Anther-specific protein SF18 precursor;... 39 0.26 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 38 0.34 UniRef50_UPI00015B4AC1 Cluster: PREDICTED: similar to conserved ... 38 0.34 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 38 0.34 UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|R... 38 0.34 UniRef50_A2X6I7 Cluster: Putative uncharacterized protein; n=2; ... 38 0.34 UniRef50_Q00486 Cluster: Mini-collagen precursor; n=2; Hydra sp.... 38 0.34 UniRef50_A7RW05 Cluster: Predicted protein; n=1; Nematostella ve... 38 0.34 UniRef50_Q7SFQ1 Cluster: Predicted protein; n=1; Neurospora cras... 38 0.34 UniRef50_P50552 Cluster: Vasodilator-stimulated phosphoprotein; ... 38 0.34 UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [C... 38 0.34 UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda... 38 0.34 UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein;... 38 0.45 UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain... 38 0.45 UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein;... 38 0.45 UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whol... 38 0.45 UniRef50_Q47LM4 Cluster: Putative uncharacterized protein; n=1; ... 38 0.45 UniRef50_A7INX6 Cluster: Putative head morphogenesis protein SPP... 38 0.45 UniRef50_A3TRM3 Cluster: Putative uncharacterized protein; n=1; ... 38 0.45 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 38 0.45 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 38 0.45 UniRef50_Q9VC23 Cluster: CG7016-PA; n=2; Sophophora|Rep: CG7016-... 38 0.45 UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; ... 38 0.45 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 38 0.45 UniRef50_A2EJF1 Cluster: LIM domain containing protein; n=4; Tri... 38 0.45 UniRef50_Q7SC37 Cluster: Predicted protein; n=1; Neurospora cras... 38 0.45 UniRef50_Q6C6N4 Cluster: Similar to DEHA0F03828g Debaryomyces ha... 38 0.45 UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos... 38 0.45 UniRef50_P41832 Cluster: Protein BNI1; n=2; Saccharomyces cerevi... 30 0.53 UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous... 38 0.60 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 38 0.60 UniRef50_UPI0000498407 Cluster: hypothetical protein 13.t00006; ... 38 0.60 UniRef50_A0GMB5 Cluster: SH3, type 3 precursor; n=2; Burkholderi... 38 0.60 UniRef50_Q6ET12 Cluster: Putative uncharacterized protein P0463G... 38 0.60 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 38 0.60 UniRef50_Q54TI7 Cluster: WH2 domain-containing protein; n=1; Dic... 38 0.60 UniRef50_Q1HMI9 Cluster: Formin C; n=3; Trypanosoma cruzi|Rep: F... 38 0.60 UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; ... 38 0.60 UniRef50_Q61900 Cluster: Submaxillary gland androgen-regulated p... 38 0.60 UniRef50_UPI00015B5315 Cluster: PREDICTED: similar to Heterogene... 37 0.79 UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, in... 37 0.79 UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-depend... 37 0.79 UniRef50_UPI0000E494ED Cluster: PREDICTED: similar to FIP1 like ... 37 0.79 UniRef50_Q4T4L4 Cluster: Chromosome undetermined SCAF9593, whole... 37 0.79 UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome s... 37 0.79 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 37 0.79 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 37 0.79 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 37 0.79 UniRef50_A1UQ48 Cluster: Peptidase S8 and S53, subtilisin, kexin... 37 0.79 UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sa... 37 0.79 UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP... 37 0.79 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 37 0.79 UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassif... 37 0.79 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 37 0.79 UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n... 37 0.79 UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; ... 37 0.79 UniRef50_A5AVJ0 Cluster: Putative uncharacterized protein; n=1; ... 37 0.79 UniRef50_Q9W0H1 Cluster: CG9184-PA, isoform A; n=5; Sophophora|R... 37 0.79 UniRef50_Q7PUR9 Cluster: ENSANGP00000008445; n=1; Anopheles gamb... 37 0.79 UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyo... 37 0.79 UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: F... 37 0.79 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 37 0.79 UniRef50_Q0U760 Cluster: Putative uncharacterized protein; n=1; ... 37 0.79 UniRef50_A3GHI1 Cluster: Predicted protein; n=1; Pichia stipitis... 37 0.79 UniRef50_A2QUG1 Cluster: Similarity to the N. crassa protein. Ad... 37 0.79 UniRef50_Q63627 Cluster: Splicing factor, arginine/serine-rich 1... 37 0.79 UniRef50_Q07048 Cluster: RNA-directed RNA polymerase; n=1; Sacch... 37 0.79 UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - ... 37 0.79 UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L spl... 37 1.0 UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En... 37 1.0 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 37 1.0 UniRef50_A1SEF2 Cluster: Putative uncharacterized protein; n=1; ... 37 1.0 UniRef50_A0R1W2 Cluster: Putative uncharacterized protein; n=1; ... 37 1.0 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 37 1.0 UniRef50_Q8MQE6 Cluster: Wasp (Actin cytoskeleton modulator) hom... 37 1.0 UniRef50_Q7PNQ0 Cluster: ENSANGP00000005715; n=2; Culicidae|Rep:... 37 1.0 UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG057... 37 1.0 UniRef50_Q5TJB8 Cluster: Diaphanous-related formin dDia2; n=2; D... 37 1.0 UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic p... 37 1.0 UniRef50_Q6C3N1 Cluster: Yarrowia lipolytica chromosome E of str... 37 1.0 UniRef50_Q5AVQ4 Cluster: Putative uncharacterized protein; n=1; ... 37 1.0 UniRef50_A6QTR5 Cluster: Adenylyl cyclase-associated protein; n=... 37 1.0 UniRef50_Q9NSV4 Cluster: Protein diaphanous homolog 3; n=66; Deu... 37 1.0 UniRef50_P19835 Cluster: Bile salt-activated lipase precursor; n... 37 1.0 UniRef50_Q4T2J8 Cluster: Chromosome undetermined SCAF10255, whol... 36 1.4 UniRef50_Q1LVB7 Cluster: Novel protein; n=5; Danio rerio|Rep: No... 36 1.4 UniRef50_A1BM55 Cluster: Capsid protein-like protein; n=2; Ovine... 36 1.4 UniRef50_Q9L252 Cluster: Putative uncharacterized protein SCO266... 36 1.4 UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1... 36 1.4 UniRef50_Q0B341 Cluster: Putative uncharacterized protein; n=4; ... 36 1.4 UniRef50_A7IPA8 Cluster: Putative uncharacterized protein precur... 36 1.4 UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein;... 36 1.4 UniRef50_Q9SXE7 Cluster: T3P18.6; n=2; core eudicotyledons|Rep: ... 36 1.4 UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. na... 36 1.4 UniRef50_Q7F0U2 Cluster: OJ1116_C07.3 protein; n=4; Oryza sativa... 36 1.4 UniRef50_Q6H899 Cluster: Nuclear protein ZAP-like; n=6; Magnolio... 36 1.4 UniRef50_Q6AVV7 Cluster: Expressed protein; n=3; Oryza sativa|Re... 36 1.4 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 36 1.4 UniRef50_O23691 Cluster: Putative uncharacterized protein T19D16... 36 1.4 UniRef50_A7QG78 Cluster: Chromosome undetermined scaffold_91, wh... 36 1.4 UniRef50_A5BAX2 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_A2XET4 Cluster: Putative uncharacterized protein; n=2; ... 36 1.4 UniRef50_Q58MX6 Cluster: Phage tail fiber-like protein; n=1; Cya... 36 1.4 UniRef50_Q4R8N9 Cluster: Testis cDNA clone: QtsA-11950, similar ... 36 1.4 UniRef50_Q54CQ8 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_A7TC21 Cluster: Predicted protein; n=1; Nematostella ve... 36 1.4 UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; ... 36 1.4 UniRef50_A0CJV0 Cluster: Chromosome undetermined scaffold_2, who... 36 1.4 UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|... 36 1.4 UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_Q0U8T6 Cluster: Predicted protein; n=1; Phaeosphaeria n... 36 1.4 UniRef50_Q9Y2W2 Cluster: WW domain-binding protein 11; n=42; Eut... 36 1.4 UniRef50_Q15428 Cluster: Splicing factor 3A subunit 2; n=69; Euk... 36 1.4 UniRef50_Q9H461 Cluster: Frizzled-8 precursor; n=10; Theria|Rep:... 36 1.4 UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=... 36 1.4 UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morp... 36 1.4 UniRef50_UPI000023F6A5 Cluster: hypothetical protein FG10389.1; ... 36 1.8 UniRef50_UPI00006A1088 Cluster: WAS/WASL interacting protein fam... 36 1.8 UniRef50_Q6P120 Cluster: Enah/Vasp-like b; n=2; Danio rerio|Rep:... 36 1.8 UniRef50_Q01U46 Cluster: Cna B domain protein; n=1; Solibacter u... 36 1.8 UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vu... 36 1.8 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 36 1.8 UniRef50_Q9W3G1 Cluster: CG10555-PA; n=2; Drosophila melanogaste... 36 1.8 UniRef50_Q9UA70 Cluster: Unconventional myosin heavy chain MyoK;... 36 1.8 UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella ve... 36 1.8 UniRef50_A2EVR8 Cluster: Putative uncharacterized protein; n=1; ... 36 1.8 UniRef50_A0CYS3 Cluster: Chromosome undetermined scaffold_31, wh... 36 1.8 UniRef50_A0CFX0 Cluster: Chromosome undetermined scaffold_177, w... 36 1.8 UniRef50_Q2H6L7 Cluster: Putative uncharacterized protein; n=3; ... 36 1.8 UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 36 1.8 UniRef50_Q9R0I7 Cluster: YLP motif-containing protein 1; n=9; Ma... 36 1.8 UniRef50_Q8TF74 Cluster: WAS/WASL-interacting protein family mem... 36 1.8 UniRef50_O43516 Cluster: WAS/WASL-interacting protein family mem... 36 1.8 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 36 1.8 UniRef50_Q16630 Cluster: Cleavage and polyadenylation specificit... 36 1.8 UniRef50_UPI0001554A4E Cluster: PREDICTED: similar to transcript... 36 2.4 UniRef50_UPI0000D9F058 Cluster: PREDICTED: hypothetical protein;... 36 2.4 UniRef50_UPI0000D55BF8 Cluster: PREDICTED: similar to CG32030-PA... 36 2.4 UniRef50_UPI0000499A11 Cluster: hypothetical protein 42.t00003; ... 36 2.4 UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein... 36 2.4 UniRef50_P42859-2 Cluster: Isoform Short of P42859 ; n=7; Deuter... 36 2.4 UniRef50_Q7SZN7 Cluster: Enah/Vasp-like a; n=3; Danio rerio|Rep:... 36 2.4 UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear... 36 2.4 UniRef50_A3QMN0 Cluster: Putative uncharacterized protein; n=2; ... 36 2.4 UniRef50_Q7UEA7 Cluster: Putative uncharacterized protein; n=1; ... 36 2.4 UniRef50_Q0SAY2 Cluster: Putative uncharacterized protein; n=1; ... 36 2.4 UniRef50_Q0S917 Cluster: Possible proline rich protein; n=1; Rho... 36 2.4 UniRef50_A7HCP7 Cluster: Signal peptide peptidase SppA, 36K type... 36 2.4 UniRef50_A1WU97 Cluster: Putative CheW protein; n=1; Halorhodosp... 36 2.4 UniRef50_A1G5R7 Cluster: Putative uncharacterized protein; n=1; ... 36 2.4 UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreoco... 36 2.4 UniRef50_P93845 Cluster: Putative uncharacterized protein; n=1; ... 36 2.4 UniRef50_A7Q8L0 Cluster: Chromosome chr5 scaffold_64, whole geno... 36 2.4 UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; ... 36 2.4 UniRef50_Q8WNT4 Cluster: Dopamine receptor D4; n=1; Nyctereutes ... 36 2.4 UniRef50_Q8IT88 Cluster: UNC-34; n=4; Caenorhabditis|Rep: UNC-34... 36 2.4 UniRef50_Q5C3I4 Cluster: SJCHGC03138 protein; n=2; Schistosoma j... 36 2.4 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 36 2.4 UniRef50_A5D6X0 Cluster: SMARCA4 protein; n=36; Deuterostomia|Re... 36 2.4 UniRef50_Q4WP21 Cluster: Small nuclear ribonucleoprotein SmB, pu... 36 2.4 UniRef50_Q0UMH1 Cluster: Putative uncharacterized protein; n=1; ... 36 2.4 UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; ... 36 2.4 UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe gri... 36 2.4 UniRef50_Q8ZSX8 Cluster: Putative uncharacterized protein PAE353... 36 2.4 UniRef50_P51532 Cluster: Probable global transcription activator... 36 2.4 UniRef50_P10165 Cluster: Proline-rich proteoglycan 2 precursor; ... 36 2.4 UniRef50_Q9U6L5 Cluster: Ejaculatory bulb-specific protein 1 pre... 36 2.4 UniRef50_P42534 Cluster: Putative polyketide hydroxylase; n=4; S... 36 2.4 UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenas... 36 2.4 UniRef50_O59907 Cluster: Annexin XIV; n=10; Pezizomycotina|Rep: ... 29 2.8 UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein;... 35 3.2 UniRef50_UPI000023E7FD Cluster: hypothetical protein FG06780.1; ... 35 3.2 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 35 3.2 UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleos... 35 3.2 UniRef50_Q6NWB3 Cluster: Splicing factor 3b, subunit 4; n=16; Eu... 35 3.2 UniRef50_Q4S708 Cluster: Chromosome 14 SCAF14723, whole genome s... 35 3.2 UniRef50_Q4RLP1 Cluster: Chromosome 10 SCAF15019, whole genome s... 35 3.2 UniRef50_Q08D38 Cluster: LOC779576 protein; n=3; Xenopus tropica... 35 3.2 UniRef50_Q9KYW6 Cluster: Putative integral membrane protein; n=2... 35 3.2 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 35 3.2 UniRef50_Q82CH7 Cluster: Putative uncharacterized protein; n=1; ... 35 3.2 UniRef50_Q743K0 Cluster: Putative uncharacterized protein; n=2; ... 35 3.2 UniRef50_Q08YB2 Cluster: Response regulator; n=4; cellular organ... 35 3.2 UniRef50_A4LPA5 Cluster: Intracellular motility protein A; n=6; ... 35 3.2 UniRef50_A0R4R5 Cluster: Putative secreted protein; n=1; Mycobac... 35 3.2 UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa... 35 3.2 UniRef50_Q9U3S8 Cluster: Putative uncharacterized protein; n=3; ... 35 3.2 UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|R... 35 3.2 UniRef50_Q0IEF4 Cluster: Vasodilator-stimulated phosphoprotein; ... 35 3.2 UniRef50_O01900 Cluster: Putative uncharacterized protein; n=2; ... 35 3.2 UniRef50_Q9C0D6 Cluster: KIAA1727 protein; n=13; Tetrapoda|Rep: ... 35 3.2 UniRef50_Q6CAY8 Cluster: Similarity; n=2; Fungi/Metazoa group|Re... 35 3.2 UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=... 35 3.2 UniRef50_Q1EA57 Cluster: Predicted protein; n=12; Pezizomycotina... 35 3.2 UniRef50_A7F7G2 Cluster: Putative uncharacterized protein; n=2; ... 35 3.2 UniRef50_A4RC80 Cluster: Putative uncharacterized protein; n=2; ... 35 3.2 UniRef50_A3LVW7 Cluster: Predicted protein; n=1; Pichia stipitis... 35 3.2 UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2;... 35 3.2 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 35 3.2 UniRef50_P49750 Cluster: YLP motif-containing protein 1; n=8; Am... 35 3.2 UniRef50_Q9LKA5 Cluster: Uncharacterized mitochondrial protein A... 35 3.2 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 35 3.2 UniRef50_Q9ULL5 Cluster: Proline-rich protein 12; n=19; Eutheria... 35 3.2 UniRef50_Q96QC0 Cluster: Serine/threonine-protein phosphatase 1 ... 35 3.2 UniRef50_O22454 Cluster: Low-affinity cation transporter; n=2; B... 27 3.6 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 35 4.2 UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein;... 35 4.2 UniRef50_UPI0000F2C478 Cluster: PREDICTED: hypothetical protein;... 35 4.2 UniRef50_UPI0000E7FD76 Cluster: PREDICTED: similar to SH3 domain... 35 4.2 UniRef50_UPI0000E4617E Cluster: PREDICTED: similar to MGC10433-l... 35 4.2 UniRef50_UPI0000384222 Cluster: COG0642: Signal transduction his... 35 4.2 UniRef50_UPI0000ECCC14 Cluster: WAS/WASL interacting protein fam... 35 4.2 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 35 4.2 UniRef50_Q9YMX1 Cluster: Essential structural protein pp78-81; n... 35 4.2 UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=... 35 4.2 UniRef50_Q04117 Cluster: Salivary proline-rich protein; n=5; Rat... 35 4.2 UniRef50_Q67RJ1 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_Q2W1I3 Cluster: Submaxillary gland androgen regulated p... 35 4.2 UniRef50_A6GGW9 Cluster: Pkn9 associate protein 1; n=1; Plesiocy... 35 4.2 UniRef50_A1U8X9 Cluster: Putative uncharacterized protein; n=3; ... 35 4.2 UniRef50_A0PNV4 Cluster: Sensor protein; n=3; Mycobacterium|Rep:... 35 4.2 UniRef50_Q9MA04 Cluster: F20B17.16; n=5; core eudicotyledons|Rep... 35 4.2 UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thali... 35 4.2 UniRef50_Q8W0F9 Cluster: C2 domain-containing protein-like; n=3;... 35 4.2 UniRef50_O48809 Cluster: T3P18.1; n=9; Eukaryota|Rep: T3P18.1 - ... 35 4.2 UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole gen... 35 4.2 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 35 4.2 UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lu... 35 4.2 UniRef50_A4S1A8 Cluster: Predicted protein; n=1; Ostreococcus lu... 35 4.2 UniRef50_A3BXB7 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_A2YCL5 Cluster: Putative uncharacterized protein; n=3; ... 35 4.2 UniRef50_Q9W064 Cluster: CG12361-PA; n=2; Sophophora|Rep: CG1236... 35 4.2 UniRef50_Q9NAN8 Cluster: Putative uncharacterized protein; n=2; ... 35 4.2 UniRef50_Q7KUL0 Cluster: CG9425-PB, isoform B; n=4; Diptera|Rep:... 35 4.2 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 35 4.2 UniRef50_Q54CK9 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_Q4X6Y4 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_Q4QAM2 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 35 4.2 UniRef50_Q19479 Cluster: Putative uncharacterized protein inft-2... 35 4.2 UniRef50_A2ECL1 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_A0DM29 Cluster: Chromosome undetermined scaffold_56, wh... 35 4.2 UniRef50_Q8WZK9 Cluster: Putative uncharacterized protein B14D6.... 35 4.2 UniRef50_Q7S4G0 Cluster: Putative uncharacterized protein NCU022... 35 4.2 UniRef50_Q5K759 Cluster: Putative uncharacterized protein; n=2; ... 35 4.2 UniRef50_Q1DS16 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 35 4.2 UniRef50_Q0UP28 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_Q0CF92 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_A6RX29 Cluster: Predicted protein; n=2; Sclerotiniaceae... 35 4.2 UniRef50_A6QS18 Cluster: Predicted protein; n=1; Ajellomyces cap... 35 4.2 UniRef50_A5E7D8 Cluster: Predicted protein; n=1; Lodderomyces el... 35 4.2 UniRef50_A4QY36 Cluster: Predicted protein; n=1; Magnaporthe gri... 35 4.2 UniRef50_Q15942 Cluster: Zyxin; n=27; Theria|Rep: Zyxin - Homo s... 35 4.2 UniRef50_O14776 Cluster: Transcription elongation regulator 1; n... 35 4.2 UniRef50_Q99954 Cluster: Submaxillary gland androgen-regulated p... 35 4.2 UniRef50_P23246 Cluster: Splicing factor, proline- and glutamine... 35 4.2 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 35 4.2 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 35 4.2 UniRef50_UPI0000F2DC0A Cluster: PREDICTED: similar to GABAA rece... 34 5.6 UniRef50_UPI0000E48DD8 Cluster: PREDICTED: similar to MGC81512 p... 34 5.6 UniRef50_UPI000049858C Cluster: hypothetical protein 101.t00009;... 34 5.6 UniRef50_UPI000023E00E Cluster: hypothetical protein FG09687.1; ... 34 5.6 UniRef50_UPI0000F30DFE Cluster: UPI0000F30DFE related cluster; n... 34 5.6 UniRef50_Q4SD73 Cluster: Chromosome 11 SCAF14642, whole genome s... 34 5.6 UniRef50_Q684D7 Cluster: Putative uncharacterized protein; n=1; ... 34 5.6 UniRef50_Q6N0Q5 Cluster: Putative uncharacterized protein precur... 34 5.6 UniRef50_Q0C0K6 Cluster: Peptidase family protein; n=1; Hyphomon... 34 5.6 UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subuni... 34 5.6 UniRef50_A4FR37 Cluster: Membrane carboxypeptidase; n=1; Sacchar... 34 5.6 UniRef50_A0R4D4 Cluster: Putative uncharacterized protein; n=1; ... 34 5.6 UniRef50_Q94FY3 Cluster: C2H2 zinc-finger protein; n=9; Magnolio... 34 5.6 UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=... 34 5.6 UniRef50_Q2XQY7 Cluster: Intraflagellar transport protein 57; n=... 34 5.6 UniRef50_Q0D806 Cluster: Os07g0192900 protein; n=5; Magnoliophyt... 34 5.6 UniRef50_Q09084 Cluster: Extensin (Class II) precursor; n=3; Sol... 34 5.6 UniRef50_Q01A68 Cluster: Chromosome 04 contig 1, DNA sequence; n... 34 5.6 UniRef50_A4RU08 Cluster: Predicted protein; n=1; Ostreococcus lu... 34 5.6 UniRef50_Q9XW73 Cluster: Putative uncharacterized protein; n=1; ... 34 5.6 UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaste... 34 5.6 UniRef50_Q9GP35 Cluster: Spliceosome-associated-protein 114; n=2... 34 5.6 UniRef50_Q17BE7 Cluster: Putative uncharacterized protein; n=2; ... 34 5.6 UniRef50_A7T0X8 Cluster: Predicted protein; n=1; Nematostella ve... 34 5.6 UniRef50_A2FDZ8 Cluster: Putative uncharacterized protein; n=1; ... 34 5.6 UniRef50_A1Z8H7 Cluster: CG13214-PA, isoform A; n=5; Eukaryota|R... 34 5.6 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 34 5.6 UniRef50_Q6CAD9 Cluster: Similarity; n=1; Yarrowia lipolytica|Re... 34 5.6 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 34 5.6 UniRef50_Q2U9I6 Cluster: Predicted protein; n=1; Aspergillus ory... 34 5.6 UniRef50_Q0UXS5 Cluster: Putative uncharacterized protein; n=1; ... 34 5.6 UniRef50_Q0UPQ0 Cluster: Putative uncharacterized protein; n=1; ... 34 5.6 UniRef50_A3GHT1 Cluster: Predicted protein; n=3; Saccharomycetac... 34 5.6 UniRef50_Q15427 Cluster: Splicing factor 3B subunit 4; n=37; Euk... 34 5.6 UniRef50_Q15637 Cluster: Splicing factor 1; n=57; Euteleostomi|R... 34 5.6 UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ... 34 5.6 UniRef50_O97214 Cluster: Putative uncharacterized protein L4830.... 27 6.0 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 34 6.2 UniRef50_UPI0000EBE25E Cluster: PREDICTED: hypothetical protein;... 34 7.4 UniRef50_UPI0000E7FC2B Cluster: PREDICTED: hypothetical protein;... 34 7.4 UniRef50_UPI0000E49FCD Cluster: PREDICTED: hypothetical protein,... 34 7.4 UniRef50_UPI0000E47BCF Cluster: PREDICTED: similar to MGC84161 p... 34 7.4 UniRef50_Q4A2U2 Cluster: Putative membrane protein precursor; n=... 34 7.4 UniRef50_Q9XAI1 Cluster: Putative serine-threonine protein kinas... 34 7.4 UniRef50_Q47T16 Cluster: Putative uncharacterized protein precur... 34 7.4 UniRef50_Q2RXX9 Cluster: Putative uncharacterized protein; n=1; ... 34 7.4 UniRef50_A4KMF6 Cluster: Conserved transmembrane protein; n=15; ... 34 7.4 UniRef50_A4FNN8 Cluster: Cell wall surface anchor family protein... 34 7.4 UniRef50_A1UKQ7 Cluster: Putative uncharacterized protein; n=3; ... 34 7.4 UniRef50_A1TE68 Cluster: Protein kinase; n=2; Mycobacterium|Rep:... 34 7.4 UniRef50_A1T164 Cluster: Putative uncharacterized protein precur... 34 7.4 UniRef50_Q9FI15 Cluster: Similarity to small nuclear ribonucleop... 34 7.4 UniRef50_Q6EQ70 Cluster: Putative uncharacterized protein OSJNBa... 34 7.4 UniRef50_Q53LC9 Cluster: Transposon protein, putative, CACTA, En... 34 7.4 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 34 7.4 UniRef50_Q0J2H9 Cluster: Os09g0341100 protein; n=8; Oryza sativa... 34 7.4 UniRef50_Q0D5P3 Cluster: Os07g0545500 protein; n=4; Magnoliophyt... 34 7.4 UniRef50_Q014T0 Cluster: Putative transcription regulatory prote... 34 7.4 UniRef50_Q013M1 Cluster: Chromosome 08 contig 1, DNA sequence; n... 34 7.4 UniRef50_Q00ZC5 Cluster: Splicing factor 1/branch point binding ... 34 7.4 UniRef50_A3A6K5 Cluster: Putative uncharacterized protein; n=3; ... 34 7.4 UniRef50_Q9GZH1 Cluster: Putative uncharacterized protein; n=1; ... 34 7.4 UniRef50_Q7PXP8 Cluster: ENSANGP00000011704; n=1; Anopheles gamb... 34 7.4 UniRef50_Q2M175 Cluster: GA21777-PA; n=2; pseudoobscura subgroup... 34 7.4 UniRef50_A7RHP4 Cluster: Predicted protein; n=3; Nematostella ve... 34 7.4 UniRef50_A2FFZ7 Cluster: Putative uncharacterized protein; n=1; ... 34 7.4 UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; ... 34 7.4 UniRef50_A0EAP8 Cluster: Chromosome undetermined scaffold_86, wh... 34 7.4 UniRef50_Q7SCK8 Cluster: Predicted protein; n=1; Neurospora cras... 34 7.4 UniRef50_Q2HGM6 Cluster: Putative uncharacterized protein; n=1; ... 34 7.4 UniRef50_Q0UQG7 Cluster: Adenylyl cyclase-associated protein; n=... 34 7.4 UniRef50_P05143 Cluster: Proline-rich protein 2 precursor; n=10;... 34 7.4 UniRef50_Q96T25 Cluster: Zinc finger protein ZIC 5; n=16; Theria... 27 8.0 UniRef50_Q8LNI0 Cluster: Putative uncharacterized protein OSJNBb... 27 8.3 UniRef50_UPI0000E46C2C Cluster: PREDICTED: similar to transcript... 33 9.8 UniRef50_UPI0000D57439 Cluster: PREDICTED: similar to protein ki... 33 9.8 UniRef50_UPI00005A02EC Cluster: PREDICTED: hypothetical protein ... 33 9.8 UniRef50_UPI0000F306C2 Cluster: UPI0000F306C2 related cluster; n... 33 9.8 UniRef50_Q63ZU8 Cluster: LOC494729 protein; n=8; Euteleostomi|Re... 33 9.8 UniRef50_Q9E938 Cluster: ICP4 protein; n=2; Gallid herpesvirus 3... 33 9.8 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 33 9.8 UniRef50_Q30UP0 Cluster: Filamentous haemagglutinin-like; n=3; T... 33 9.8 UniRef50_Q3VZ23 Cluster: Putative uncharacterized protein; n=1; ... 33 9.8 UniRef50_A6G5Q9 Cluster: Zinc finger/thioredoxin putative; n=1; ... 33 9.8 UniRef50_A3VL73 Cluster: Putative RTX toxin; n=1; Rhodobacterale... 33 9.8 UniRef50_A1UGS6 Cluster: Fibronectin-attachment family protein p... 33 9.8 UniRef50_Q9FLK6 Cluster: Arabidopsis thaliana genomic DNA, chrom... 33 9.8 UniRef50_Q9FF14 Cluster: Similarity to unknown protein; n=3; Ara... 33 9.8 UniRef50_Q9ATK5 Cluster: PF6 protein; n=1; Chlamydomonas reinhar... 33 9.8 UniRef50_Q8RZX3 Cluster: Putative uncharacterized protein P0413C... 33 9.8 UniRef50_Q6PSU8 Cluster: Formin homology 2 domain-containing pro... 33 9.8 UniRef50_Q67W58 Cluster: Putative ethylene-inducible CTR1-like p... 33 9.8 UniRef50_Q3EDB7 Cluster: Uncharacterized protein At1g15830.1; n=... 33 9.8 UniRef50_Q01JG9 Cluster: H0818E04.14 protein; n=7; Oryza sativa|... 33 9.8 UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=... 33 9.8 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 33 9.8 UniRef50_A4RXC9 Cluster: Predicted protein; n=1; Ostreococcus lu... 33 9.8 UniRef50_A2Y1N3 Cluster: Putative uncharacterized protein; n=1; ... 33 9.8 UniRef50_Q7PM08 Cluster: ENSANGP00000004598; n=2; Culicidae|Rep:... 33 9.8 UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; ... 33 9.8 UniRef50_Q3ZAP0 Cluster: RE20030p; n=1; Drosophila melanogaster|... 33 9.8 UniRef50_Q1ZXG9 Cluster: Argonaut-like protein; n=1; Dictyosteli... 33 9.8 UniRef50_A7RG77 Cluster: Predicted protein; n=1; Nematostella ve... 33 9.8 UniRef50_Q7S9L7 Cluster: Predicted protein; n=2; Sordariales|Rep... 33 9.8 UniRef50_Q5BEN1 Cluster: Adenylyl cyclase-associated protein; n=... 33 9.8 UniRef50_Q2HAW1 Cluster: Putative uncharacterized protein; n=1; ... 33 9.8 UniRef50_Q0UJJ7 Cluster: Putative uncharacterized protein; n=1; ... 33 9.8 UniRef50_Q0UAV3 Cluster: Putative uncharacterized protein; n=1; ... 33 9.8 >UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyostelium discoideum|Rep: Formin homology protein A - Dictyostelium discoideum (Slime mold) Length = 1218 Score = 55.2 bits (127), Expect = 3e-06 Identities = 35/106 (33%), Positives = 36/106 (33%), Gaps = 4/106 (3%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 GGG PPPP PPPP G PPPP GGG Sbjct: 659 GGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPP 718 Query: 136 GGPPPXPPPXXXGGPXFXPXXRXVIPP----SRGLKLTAXPSXSXV 11 PPP PP GGP P PP G+K A P V Sbjct: 719 --PPPPPPGAKAGGPPPPPPPFGKGPPPPPGGFGMKKAAAPPRKEV 762 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G G PPP PPP GG P P P Sbjct: 668 PPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPP 721 Score = 47.6 bits (108), Expect = 6e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP--XXGGPXFXP 81 PPPP G PPPP G GGPPP PPP GGP P Sbjct: 653 PPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPP 696 Score = 47.2 bits (107), Expect = 7e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXG--GGXXGGPPPXPPPXXXGGPXFXP 80 PPPP GAPPPP GG PPP PPP GGP P Sbjct: 653 PPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPP 696 Score = 43.6 bits (98), Expect = 0.009 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP G PPPP GG PPP PP GGP P P P Sbjct: 669 PPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPPP 722 Score = 41.9 bits (94), Expect = 0.028 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G PP GGGPP PPPP GGG P GGG Sbjct: 675 GGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGG 716 Score = 38.3 bits (85), Expect = 0.34 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP GGG PPP PP GGP P Sbjct: 651 PPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPP 682 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 178 APPPPXXXXGGGXXGGPPPXPPPXXXGG 95 APPPP GG PPP PPP GG Sbjct: 649 APPPPPPPMTGGGAPPPPPPPPPMTGGG 676 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP GG PP PPPP GGGG P Sbjct: 651 PPPPPPMTGGGAPPPPPPPPPMTGGGGPP 679 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 G PP GGGPP PPPP GGG P Sbjct: 661 GAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPP 694 Score = 36.7 bits (81), Expect = 1.0 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = +1 Query: 97 PPXXGGGXX------GGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GGG GGGPP PPPP GG P G G Sbjct: 699 PPMTGGGPPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPPFGKG 741 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP GGG PPP PPP GG P GP Sbjct: 651 PPPPPPMTGGGAP--PPPPPPPPMTGGGGPPPPPPPPPMTGGGP 692 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 GPP GG PP PPPP GG P G G Sbjct: 705 GPPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPPFGKG 741 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAP 182 PP GG PP PPP GGGG P Sbjct: 651 PPPPPPMTGGGAPPPPPPPPPMTGGGGPP 679 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP GGG P PPPP GGG P Sbjct: 650 PPPPPPPMTGGGAPPPPPPPPPMTGGGGP 678 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 G PP GGG P PPPP GGG P Sbjct: 660 GGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPP 693 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAP 182 G PP GGGPP PPP GGG P Sbjct: 661 GAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPP 694 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 46 GPXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 GP + G PP GGGPP PPPP GGG P Sbjct: 677 GPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPP----GGGPP 718 >UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b; n=6; cellular organisms|Rep: Cytokinesis defect protein 1, isoform b - Caenorhabditis elegans Length = 1437 Score = 54.8 bits (126), Expect = 4e-06 Identities = 28/87 (32%), Positives = 30/87 (34%) Frame = -1 Query: 310 GGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGG 131 GG PPPP PPPP G PPPP GG GG Sbjct: 724 GGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGG 783 Query: 130 PPPXPPPXXXGGPXFXPXXRXVIPPSR 50 PPP PPP P +PP + Sbjct: 784 PPPPPPPGMFA--PMAPVIPDYLPPKK 808 Score = 39.5 bits (88), Expect = 0.15 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -1 Query: 205 PPP--PXXXXGAPPPPXXXXGGGXXGGPPPXPP----PXXXGGPXFXPXXRXVIPP 56 PPP P G PPPP GGPPP PP P GGP P PP Sbjct: 715 PPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPP 770 Score = 36.3 bits (80), Expect = 1.4 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 7/49 (14%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXG-----GGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP G GG PPP PP GGP P Sbjct: 714 PPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPP 762 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 200 PPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PP PPP GG PPP PP GGP P Sbjct: 707 PPITGGPPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPP 746 Score = 33.5 bits (73), Expect = 9.8 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 49 PXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 P G L G PP G GGPP PPPP GG P GG Sbjct: 730 PPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPP---PGGCPPPPPPPPPGG 779 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 53.6 bits (123), Expect = 9e-06 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PPPP GG G PPP PPP GGP P Sbjct: 1059 PPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPP 1100 Score = 52.0 bits (119), Expect = 3e-05 Identities = 23/43 (53%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP-XXGGPXFXP 81 PPPP G PPPP GG GGPPP PPP GGP P Sbjct: 1058 PPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPP 1100 Score = 47.6 bits (108), Expect = 6e-04 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP G PPPP GG GGPPP PPP G Sbjct: 1073 PPPPPGGFGGPPPPPPPPGG--FGGPPPPPPPPPGG 1106 Score = 47.2 bits (107), Expect = 7e-04 Identities = 21/40 (52%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 206 PPPPXXXXGX---PPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP GG GGPPP PPP GG Sbjct: 1040 PPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGG 1079 Score = 47.2 bits (107), Expect = 7e-04 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP GG GGPPP PPP G Sbjct: 1073 PPPPPGGFGGPPPPPPPPGG--FGGPPPPPPPPPGG 1106 Score = 46.8 bits (106), Expect = 0.001 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP G PPPP GG G PPP PPP Sbjct: 1086 PPPPPGGFGGPPPPPPPPPGGAFGVPPPPPPP 1117 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/40 (52%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -1 Query: 205 PPPPXXXXGA---PPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP GA PPPP G GGPPP PPP GG Sbjct: 1040 PPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGG 1079 Score = 44.0 bits (99), Expect = 0.007 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP G PPPP GG PPP PP GG Sbjct: 1087 PPPPGGFGGPPPPPPPPPGGAFGVPPPPPPPGTVIGG 1123 Score = 43.6 bits (98), Expect = 0.009 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPPP G PPPP GG G PPP PP Sbjct: 1086 PPPPPGGFGGPPPPPPPPPGGAFGVPPPPPPP 1117 Score = 40.3 bits (90), Expect = 0.085 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G G PPP PPP GG P PP Sbjct: 1034 PPPP------PPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPP 1077 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GG G PP PPPP GG P GG G Sbjct: 1058 PPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFG 1094 Score = 37.1 bits (82), Expect = 0.79 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 7/60 (11%) Frame = -3 Query: 206 PPPPXXXXGX-------PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP G PPPP G G PPP PPP G P P G Sbjct: 1020 PPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGG 1079 Score = 36.3 bits (80), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP PPP G PPP PPP G P PP GL Sbjct: 1016 PPPPPP----PPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGL 1065 Score = 35.9 bits (79), Expect = 1.8 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 7/60 (11%) Frame = -1 Query: 205 PPPPXXXXGA-------PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP G PPPP G PPP PPP G P PP G Sbjct: 1020 PPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGG 1079 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 PP GG GG PP PPP GG P GG Sbjct: 1057 PPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGG 1092 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 PP G GG PP PPPP GG P GG Sbjct: 1057 PPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGG 1092 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 76 LXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGG 201 L G PP G GG PP PPPP G P GG Sbjct: 1065 LGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGG 1106 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 PP GG GGPP PPPP GG P GG Sbjct: 1073 PPPPPGGF--GGPPPPPPPPGGFGGPPPPPPPPPGG 1106 Score = 33.9 bits (74), Expect = 7.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 PP GG G PP PPP GG P GG G Sbjct: 1058 PPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFG 1094 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 52.4 bits (120), Expect = 2e-05 Identities = 25/50 (50%), Positives = 26/50 (52%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G PPPP G G GGPPP PPP GGP P +PP Sbjct: 446 PPPPGMGGGPPPPPPPPPGPG--GGPPP-PPPPPGGGPPGPPPPPAQLPP 492 Score = 51.2 bits (117), Expect = 5e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G G G PPP PPP GG P P P Sbjct: 431 PPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGPP 484 Score = 50.4 bits (115), Expect = 8e-05 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G G G PPP PPP GGP P P P Sbjct: 445 PPPPPGMGGGPPPPPPPPPGPGGGPPPP--PPPPGGGPPGPPPPPAQLPPGFAP 496 Score = 48.4 bits (110), Expect = 3e-04 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G G PPP PPP GG P P GP Sbjct: 417 PPPPPPPGGVPPPPPPPPPGMGGAPPPPPPPPPGMGGGP-PPPPPPPPGPGGGP 469 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G GG PPP PP GGP P P P Sbjct: 432 PPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGPPP 485 Score = 42.7 bits (96), Expect = 0.016 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP--PXPPPXXXGGPXFXP 80 PPPP G PPPP G G PP P PPP GGP P Sbjct: 417 PPPPPPPGGVPPPPPPPPPG-MGGAPPPPPPPPPGMGGGPPPPP 459 Score = 41.9 bits (94), Expect = 0.028 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G PP G GGGPP PPP GGG P GGG Sbjct: 438 GGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGG 479 Score = 41.9 bits (94), Expect = 0.028 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G PP GGGPP PPPP GGG P GGG Sbjct: 438 GGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGG 479 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 G PP GG PP PPPP GGG P Sbjct: 424 GGVPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPP 457 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 167 GGGGXPXXXXXXXXXXXXXXXXPPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 G GG P PPPPPP P GGG PPP Sbjct: 436 GMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGPPP 485 >UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1126 Score = 51.2 bits (117), Expect = 5e-05 Identities = 25/61 (40%), Positives = 27/61 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PP P G PPPP GGPPP PPP GGP P PP G+K P Sbjct: 552 PPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPP------PPPGGMKKPGAP 605 Query: 25 S 23 + Sbjct: 606 A 606 Score = 48.4 bits (110), Expect = 3e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PP P G PPPP GGPPP PPP GGP P Sbjct: 552 PPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPP 593 Score = 44.8 bits (101), Expect = 0.004 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP GGG PPP PP GGP P P P Sbjct: 545 PPPPP-----PPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPP 593 Score = 40.3 bits (90), Expect = 0.085 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP G PPPP GGPPP PPP Sbjct: 567 PPPPPSSGGGPPPPPPPPSS---GGPPPPPPPP 596 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP GGGPP PPPP GGG P Sbjct: 550 PPPPAPPVSGGGPPPPPPPPPPSSGGGPP 578 Score = 36.7 bits (81), Expect = 1.0 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 2/76 (2%) Frame = -1 Query: 313 GGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXG 134 G PPPP PPPP G PPPP GG Sbjct: 543 GAPPPPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPPGGMKKP 602 Query: 133 GPPPXP--PPXXXGGP 92 G P P PP P Sbjct: 603 GAPAVPNLPPKKSSVP 618 Score = 36.7 bits (81), Expect = 1.0 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP---PXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP PPPP GG GPP P PPP GGP P PPS G Sbjct: 545 PPPPP-----PPPPAPPVSGG---GPPPPPPPPPPSSGGGPPPPPP-----PPSSG 587 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAP 182 PP GGGPP PPP GGG P Sbjct: 550 PPPPAPPVSGGGPPPPPPPPPPSSGGGPP 578 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 51.2 bits (117), Expect = 5e-05 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP GAPPPP GG PPP PPP G P P PP G Sbjct: 523 PPPPPPGAGAPPPPPPPAGGAP---PPPPPPPPKGGAPPPPPPPARAPPPPAG 572 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP G PPPP GG PPP PPP G P P P G Sbjct: 523 PPPPPPGAGAPPPPPPPAGG---APPPPPPPPPKGGAPPPPPPPARAPPPPAG 572 Score = 39.5 bits (88), Expect = 0.15 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP APPPP PP PPP P P IPP Sbjct: 98 PPPPPPKSDAPPPPPARPPPPPPTAPPATPPPPPPNHPPPPPPKSNDIPP 147 Score = 39.5 bits (88), Expect = 0.15 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-XXPPPXXGGP 93 PPPP PPPP GG PPP PPP G P Sbjct: 536 PPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPPAGTP 574 Score = 33.9 bits (74), Expect = 7.4 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 7/60 (11%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGG-------GGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP G PP P G G G PPP PP P P + +P P Sbjct: 502 PPPPSAPGVPPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPP 561 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = -1 Query: 205 PPPPXXXXGAPPPPX---XXXGGGXXGGPPPXPPPXXXGGP 92 PPPP GAPPPP G PP PP G P Sbjct: 534 PPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPPAGTP 574 >UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1220 Score = 50.4 bits (115), Expect = 8e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP GG G PPP PP GGP P P P Sbjct: 584 PPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPPPP 637 Score = 39.9 bits (89), Expect = 0.11 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP--PXPPPXXXGGPXFXP 80 PPPP G PPPP GG G P P PPP GGP P Sbjct: 585 PPPPMMGGGPPPPPPPPMMGG---GGPPPPPPPPMMGGGPPPPP 625 Score = 38.7 bits (86), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +1 Query: 76 LXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 + G PP GGGPP PPPP GG P G GG Sbjct: 589 MMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGG 632 Score = 36.7 bits (81), Expect = 1.0 Identities = 20/44 (45%), Positives = 21/44 (47%) Frame = +1 Query: 76 LXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 + G PP GGGPP PPPP GG G P GGGG Sbjct: 602 MMGGGGPPPPPPPPMMGGGPP-PPPP---MGGKGGPPPPPGGGG 641 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPP APPPP GG PPP PPP GG Sbjct: 577 PPPAPP--APPPPPMMGGG-----PPPPPPPPMMGG 605 >UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU07438.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU07438.1 - Neurospora crassa Length = 636 Score = 50.0 bits (114), Expect = 1e-04 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PP P GAPPPP GG G PPP PPP G P P +PP G Sbjct: 499 PPMPAPSGGAPPPPPPPPPGGMGGVPPPPPPPPPGGMP---PPPAPALPPVDG 548 Score = 44.8 bits (101), Expect = 0.004 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PP P G PPPP GG G PPP PPP G P Sbjct: 499 PPMPAPSGGAPPPPPPPPPGGMGGVPPPPPPPPPGGMP 536 Score = 37.5 bits (83), Expect = 0.60 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXG-GGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 P PP APPPP GG PP PPP GG P PP Sbjct: 482 PAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPPPGGMGGVPPPPPPPPP 532 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PP P PPPP G PPP PPP G Sbjct: 484 PPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPPPGG 519 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPPP G PPPP GG P P PP Sbjct: 514 PPPPGGMGGVPPPPPPPPPGGMPPPPAPALPP 545 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PP PPPP GG PP PPP GG P P P Sbjct: 484 PPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPPPGGMGGVPPPPPPPPPGGMP 536 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPP GG PP PP G Sbjct: 513 PPPPPGGMGGVPPPPPPPPPGGMPPPPAPALPPVDG 548 >UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|Rep: Protein diaphanous - Drosophila melanogaster (Fruit fly) Length = 1091 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP GAPPPP G GGPPP PPP G Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPG 549 Score = 50.0 bits (114), Expect = 1e-04 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PP P G PPPP G GGPPP PPP GGP P P GP Sbjct: 529 PPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPP-PPPMPGMMRPGGGP 581 Score = 50.0 bits (114), Expect = 1e-04 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PP P G PPPP G GGPPP PPP GGP P Sbjct: 529 PPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 49.6 bits (113), Expect = 1e-04 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP---XXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G GGPPP PPP GGP P P P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 46.8 bits (106), Expect = 0.001 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 GGGG PPPP PPPP G PPPP Sbjct: 519 GGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPG 578 Query: 136 GGPPPXP 116 GGPPP P Sbjct: 579 GGPPPPP 585 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 G PP G GGGPP PPPP GG P Sbjct: 522 GAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPP 555 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP GGG G PP PPPP GGG P Sbjct: 515 PPPPGGG---GAPPPPPPPMPGRAGGGPP 540 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP G GG PP PPPP GG P G G Sbjct: 528 PPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMG 564 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAP 182 G PP G GGGPP PPP GG P Sbjct: 522 GAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPP 555 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP G PPPP G GG PP GGP P Sbjct: 544 PPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAP 182 PP GG GG PP PPP GGG P Sbjct: 514 PPPPPGG--GGAPPPPPPPMPGRAGGGPP 540 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 76 LXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 + G GPP GGPP PP P GGG P Sbjct: 547 MPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPP 582 >UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Rep: Os07g0596300 protein - Oryza sativa subsp. japonica (Rice) Length = 754 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP GAPPPP GG PPP P G P P PP RG Sbjct: 234 PPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRG 286 Score = 44.8 bits (101), Expect = 0.004 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG-PXFXPXXXEXNSPXXGPXA 39 PPPP G PPPP G GG PPP P GG P P P GP A Sbjct: 234 PPPPSTRLGAPPPP-PPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRGPGA 289 Score = 41.5 bits (93), Expect = 0.037 Identities = 21/56 (37%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP--XXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G GPPP PPP P P ++P P Sbjct: 183 PPPPGARPGPPPPPPPP---GARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPP 235 Score = 41.5 bits (93), Expect = 0.037 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP--XXXGGPXFXPXXRXVIPP 56 PPPP G PPPP G G PPP PPP P P R PP Sbjct: 183 PPPPGARPGPPPPPPPP--GARPGPPPPPPPPGGRPSAPPLPPPGGRASAPP 232 Score = 39.9 bits (89), Expect = 0.11 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Frame = -1 Query: 205 PPPPXXXXGAPP--------PPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP GAPP PP G G PPP PPP GP P Sbjct: 160 PPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPP 209 Score = 38.7 bits (86), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP G P P GG PPP PPP Sbjct: 206 PPPPPPPGGRPSAPPLPPPGGRASAPPPPPPP 237 Score = 37.5 bits (83), Expect = 0.60 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP APPPP G PP PPP P P R PP Sbjct: 146 PPPPTTHFNAPPPPPPPPIT-RSGAPPSPPPPPSPPPPPPPPGARPGPPP 194 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP APP P GG PPP PP G P P Sbjct: 209 PPPPGGRPSAPPLP--PPGGRASAPPPPPPPSTRLGAPPPPP 248 Score = 36.3 bits (80), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG---PXFXPXXRXVIPPS 53 PPPP APPPP PPP PP P P R PPS Sbjct: 119 PPPPISHSNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPS 172 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PP P APPPP PPP PPP G P PP Sbjct: 132 PPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPP 181 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPP APPPP G PPP PPP G Sbjct: 222 PPPGGRASAPPPPPPP--STRLGAPPPPPPPGAGG 254 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPPP G P P GG PPP PP Sbjct: 206 PPPPPPPGGRPSAPPLPPPGGRASAPPPPPPP 237 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP + PPPP PPPP PPP Sbjct: 46 PPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPP-PPPPPSAPSSRAFSSAPPP 104 Query: 121 XPPP 110 PPP Sbjct: 105 PPPP 108 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP---PPXXGGP 93 PP P G PPPP GG PPP P PP G P Sbjct: 260 PPAPGGRLGGPPPPPPP---GGRAPPPPRGPGAPPPPGGNP 297 Score = 34.3 bits (75), Expect = 5.6 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G G P P PPP P P PP Sbjct: 25 PPPP------PPPPPPRSGVGGNTPPAPPPPPLRSTVPAISPPPPPPPPP 68 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PP P PPPP G G PPP PP GP P Sbjct: 170 PPSPPPPPSPPPPPPPP--GARPGPPPPPPPPGARPGPPPPP 209 Score = 33.9 bits (74), Expect = 7.4 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG---PXFXPXXXEXNSPXXGP 45 PPP PPPP PPP PPP P P N+P P Sbjct: 78 PPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPP 133 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP +PPPP G PPP PP G P P Sbjct: 173 PPPPP----SPPPPPPPPGARPGPPPPPPPPGARPGPPPPPP 210 Score = 33.5 bits (73), Expect = 9.8 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXX---XXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP APPPP GGPPP PPP GG P PP G Sbjct: 247 PPPPGAGGRAPPPPPAPGG-----RLGGPPPPPPP---GGRAPPPPRGPGAPPPPG 294 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 G + PP GG GGPP PPP GG AP G G Sbjct: 253 GGRAPPPPPAPGGRLGGPPPPPPP-----GGRAPPPPRGPG 288 Score = 30.3 bits (65), Expect(2) = 0.25 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP F PPP Sbjct: 82 PPPPPPPPPSAPSSRAFSSAPPPPPPPP 109 Score = 27.5 bits (58), Expect(2) = 0.25 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +2 Query: 170 GGGXPXXXXXXXXXXXXXXXXPPPPPPPP 256 GG P PPPPPPPP Sbjct: 39 GGNTPPAPPPPPLRSTVPAISPPPPPPPP 67 >UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like - Strongylocentrotus purpuratus Length = 801 Score = 48.8 bits (111), Expect = 2e-04 Identities = 21/37 (56%), Positives = 21/37 (56%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP GAPPPP G G G PPP PPP GG Sbjct: 257 PPPPPMMGGAPPPPPPPPGPG--GAPPPPPPPGMFGG 291 Score = 44.0 bits (99), Expect = 0.007 Identities = 24/55 (43%), Positives = 25/55 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLK 41 PPPP GAPPPP G GGPPP P GG R + PS LK Sbjct: 270 PPPPPGPGGAPPPPPPPGMFGG-GGPPPPPGAPPFGGMSAPIKKRDLPKPSNPLK 323 Score = 43.6 bits (98), Expect = 0.009 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP GG G PPP PP G Sbjct: 270 PPPPPGPGGAPPPPPPPGMFGGGGPPPPPGAPPFGG 305 Score = 43.2 bits (97), Expect = 0.012 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP G G G PPP PP GG Sbjct: 257 PPPPPMMGGAPPPPPPPPGPG--GAPPPPPPPGMFGG 291 Score = 42.3 bits (95), Expect = 0.021 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPP G G GGPPP P GG Sbjct: 269 PPPPPPGPGGAPPPPPPPGMFGGGGPPPPPGAPPFGG 305 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 181 GAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 GAPPPP GG PPP PPP G P P Sbjct: 254 GAPPPPPPMMGGAP---PPPPPPPGPGGAPPPPP 284 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAP 182 PP G GG PP PPP GGG P Sbjct: 268 PPPPPPPGPGGAPPPPPPPGMFGGGGPPP 296 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP GG PP PPPP GGG P Sbjct: 268 PPPPPPPGPGGAPPPPPPPGMFGGGGPPP 296 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 182 GXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 G PPPP G G PPP PPP GG Sbjct: 254 GAPPPPPPMMG----GAPPPPPPPPGPGG 278 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 48.8 bits (111), Expect = 2e-04 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP GAPPPP G G PPP PP GP P R PP G Sbjct: 1124 PPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPR---PPGGG 1173 Score = 48.0 bits (109), Expect = 4e-04 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPP GG G G PPP PPP G P P GP Sbjct: 1123 PPPPPPMRGGAPPPPPPPGGRGPGAPPP--PPPPGGRAPGPPPPPGPRPPGGGP 1174 Score = 47.6 bits (108), Expect = 6e-04 Identities = 25/53 (47%), Positives = 25/53 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP GAPPPP G G PPP PPP G P P PP RG Sbjct: 1088 PPPPPMRGGAPPPPPPPMRG---GAPPPPPPPMHGGAPPPPP------PPMRG 1131 Score = 46.4 bits (105), Expect = 0.001 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG-PXFXPXXRXVIPP 56 PPPP GAPPPP G G PPP PPP G P P R PP Sbjct: 1039 PPPPPMHGGAPPPPPPPPMHG--GAPPPPPPPMFGGAQPPPPPPMRGGAPP 1087 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP GAPPPP G G PPP PPP G P P Sbjct: 1076 PPPPPMRGGAPPPPPPPMRG---GAPPPPPPPMRGGAPPPPP 1114 Score = 45.2 bits (102), Expect = 0.003 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = -1 Query: 313 GGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXG 134 G G PPPP PPPP PPPP GG Sbjct: 978 GYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAP- 1036 Query: 133 GPPPXPPPXXXGGPXFXP 80 PPP PPP G P P Sbjct: 1037 -PPPPPPPMHGGAPPPPP 1053 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP GAPPPP G G PPP PPP GG Sbjct: 1026 PPPPPMHGGAPPPPPPPPMHG--GAPPPPPPPPMHGG 1060 Score = 44.0 bits (99), Expect = 0.007 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP G G PPP PPP G P P Sbjct: 959 PPPPPPSYGSPPPPPPPPPGYG-SPPPPPPPPPSYGSPPPPP 999 Score = 44.0 bits (99), Expect = 0.007 Identities = 24/76 (31%), Positives = 24/76 (31%) Frame = -1 Query: 307 GXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGP 128 G PPPP PPPP PPPP GG P Sbjct: 993 GSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGG--APP 1050 Query: 127 PPXPPPXXXGGPXFXP 80 PP PPP G P P Sbjct: 1051 PPPPPPMHGGAPPPPP 1066 Score = 44.0 bits (99), Expect = 0.007 Identities = 23/56 (41%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG--PXFXPXXXEXNSPXXGP 45 PPPP G PPPP G G PPP PPP GG P P +P P Sbjct: 1013 PPPPPMHGGAPPPPPPPPMHG--GAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPP 1066 Score = 44.0 bits (99), Expect = 0.007 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPP GG G PPP P P GGP P Sbjct: 1137 PPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPRPPGGGPPPPP 1178 Score = 43.6 bits (98), Expect = 0.009 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G G PPP PP G P P +P P Sbjct: 1076 PPPPPMRGGAPPPPPPPMRG---GAPPPPPPPMRGGAPPPPPPPMHGGAPPPPP 1126 Score = 43.2 bits (97), Expect = 0.012 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 8/62 (12%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGG--------XGGPPPXXPPPXXGGPXFXPXXXEXNSPXX 51 PPPP G PPPP GG GG PP PPP GP P Sbjct: 1100 PPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAP 1159 Query: 50 GP 45 GP Sbjct: 1160 GP 1161 Score = 43.2 bits (97), Expect = 0.012 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP GAPPPP G G PPP PPP G Sbjct: 1112 PPPPPMHGGAPPPPPPPMRG---GAPPPPPPPGGRG 1144 Score = 42.7 bits (96), Expect = 0.016 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G+PPPP G PPP PPP G P P Sbjct: 959 PPPPPPSYGSPPPPPPPP-PGYGSPPPPPPPPPSYGSPPPPP 999 Score = 41.9 bits (94), Expect = 0.028 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G PPP PP P P SP P Sbjct: 946 PPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPPPP 999 Score = 41.9 bits (94), Expect = 0.028 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 9/63 (14%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGG--------XGGPPPXXPPPXXGG-PXFXPXXXEXNSPX 54 PPPP G PPPP GG GG PP PPP GG P P +P Sbjct: 1052 PPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPP 1111 Query: 53 XGP 45 P Sbjct: 1112 PPP 1114 Score = 41.5 bits (93), Expect = 0.037 Identities = 22/53 (41%), Positives = 23/53 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP G+PPPP PPP PPP G P P PPS G Sbjct: 946 PPPPPPSYGSPPPPPPPPPS-YGSPPPPPPPPPGYGSPPPPPPP----PPSYG 993 Score = 41.1 bits (92), Expect = 0.049 Identities = 23/55 (41%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG-PXFXPXXXEXNSPXXGP 45 PPPP G PPPP GG PPP PPP GG P P +P P Sbjct: 1088 PPPPPMRGGAPPPPPPPMRGGAP--PPP--PPPMHGGAPPPPPPPMRGGAPPPPP 1138 Score = 40.7 bits (91), Expect = 0.064 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPP GAPPPP GG G PPP P GGP P Sbjct: 1138 PPPGGRGPGAPPPPPPP-GGRAPGPPPPPGPRPPGGGPPPPP 1178 Score = 40.3 bits (90), Expect = 0.085 Identities = 26/61 (42%), Positives = 26/61 (42%), Gaps = 11/61 (18%) Frame = -1 Query: 205 PPPPXX-XXGAPPPPXXXXGGG--------XXGGPPPXPPPXXXGG--PXFXPXXRXVIP 59 PPPP GAPPPP GG GG PP PPP GG P P R P Sbjct: 1051 PPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAP 1110 Query: 58 P 56 P Sbjct: 1111 P 1111 Score = 39.9 bits (89), Expect = 0.11 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP GG PPP PP G P +P P Sbjct: 1039 PPPPPMHGGAPPPPPPPPMHGG--APPPPPPPMFGGAQPPPPPPMRGGAPPPPP 1090 Score = 39.5 bits (88), Expect = 0.15 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP GAPPPP GG PPP PP P P Sbjct: 1100 PPPPPMRGGAPPPPPPPMHGGAP--PPPPPPMRGGAPPPPPP 1139 Score = 38.7 bits (86), Expect = 0.26 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP G+PPPP G PPP PPP Sbjct: 972 PPPPPPGYGSPPPPPPPPPS--YGSPPPPPPP 1001 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP G PPP PPP G P P Sbjct: 935 PPPPSYGSPPPPPPPPPSYGSP---PPPPPPPPSYGSPPPPP 973 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP G PPPP G PPP PPP Sbjct: 972 PPPPPPGYGSPPPPPPPPPS--YGSPPPPPPPP 1002 Score = 37.1 bits (82), Expect = 0.79 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP G PPP PPP G P P Sbjct: 935 PPPPSY--GSPPPPPPPPPSYG-SPPPPPPPPPSYGSPPPPP 973 Score = 36.7 bits (81), Expect = 1.0 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG--PXFXPXXXEXNSPXXGP 45 PPPP G PPPP PPP PPP GG P P +P P Sbjct: 987 PPPPSY--GSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPP 1040 Score = 35.9 bits (79), Expect = 1.8 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG--PXFXPXXXEXNSPXXGP 45 PPP PPPP GG PPP PPP GG P P +P P Sbjct: 1000 PPPFSHVSSIPPPPPPPPMHGGAPPPPP--PPPMHGGAPPPPPPPPMHGGAPPPPP 1053 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPP PPPP G PPP PP P P PP Sbjct: 935 PPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPP 983 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G P P G GG PP PP G P Sbjct: 1148 PPPPPPPGGRAPGPPPPPGPRPPGGGPPPPPMLGARGAAVDP 1189 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 76 LXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 + G PP GG G PP PPPP G P GG Sbjct: 1129 MRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPRPPGG 1172 >UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 1215 Score = 48.8 bits (111), Expect = 2e-04 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP PPPP GAPPPP G PPP Sbjct: 646 PPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPP 705 Query: 121 XPPPXXXGGPXFXP 80 PPP G P P Sbjct: 706 PPPPRIGGAPPPPP 719 Score = 43.6 bits (98), Expect = 0.009 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGG--GXXGGPPPXPPPXXXGGPXFXPXXR 71 PPPP GAPPPP G PPP PPP G P P R Sbjct: 664 PPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPPPR 710 Score = 39.1 bits (87), Expect = 0.20 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG--GGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G PPP PP G P P +P P Sbjct: 664 PPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPPPRIGGAPPPPP 719 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP GAPPPP GG PP PPP Sbjct: 693 PPPPPSKTGAPPPPPPPR----IGGAPPPPPP 720 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP 123 PPPP G PPPP GG PPP Sbjct: 693 PPPPPSKTGAPPPPPPPRIGGAPPPPPP 720 >UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: Formin B - Trypanosoma brucei TREU927 Length = 1004 Score = 48.4 bits (110), Expect = 3e-04 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = -1 Query: 313 GGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXG 134 GG PPPP PPPP GAPPPP G G Sbjct: 495 GGKLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPPPPPGKLGPG 554 Query: 133 GPPPXPPPXXXGG 95 G PP PPP G Sbjct: 555 GGPPPPPPPPPRG 567 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP G G GG PP PPP G Sbjct: 531 PPPPPGGKGAPPPPPPPPGKLGPGGGPPPPPPPPPRG 567 Score = 42.7 bits (96), Expect = 0.016 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP PPPP G G PPP PPP GP P PP RGL Sbjct: 521 PPPPPGGKLPPPPPP-----GGKGAPPPPPPPPGKLGPGGGPPPPPP-PPPRGL 568 Score = 41.5 bits (93), Expect = 0.037 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP GG G PPP PPP GP P Sbjct: 521 PPPPPGGKLPPPPPP-----GGKGAPPPPPPPPGKLGPGGGP 557 Score = 38.7 bits (86), Expect = 0.26 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPPP GG PPP PPP P P PP G KL P Sbjct: 480 PPPPPVKLPPPPPPP----GGKL--PPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPP 533 Score = 38.7 bits (86), Expect = 0.26 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGP-PPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP PPPP GG PP PPP G P P + P G Sbjct: 503 PPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPPPPPGKLGPGGG 556 Score = 38.3 bits (85), Expect = 0.34 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP---PPXXXGG---PXFXPXXRXVIPP 56 PPPP G PPP GG PPP P PP GG P P + PP Sbjct: 488 PPPPPPPGGKLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPP 543 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP---XXPPPXXGG 96 PPPP G PPP GG PPP PPP GG Sbjct: 488 PPPPPPPGGKLPPPPPPPPGGKLPPPPPPPGKAPPPPPGG 527 Score = 36.7 bits (81), Expect = 1.0 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGP-PPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP GG PP PP G P P P GP Sbjct: 503 PPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPPPPPGKLGPGGGP 557 Score = 35.5 bits (78), Expect = 2.4 Identities = 21/60 (35%), Positives = 22/60 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPPP GG P PPP P P + PP G K P Sbjct: 489 PPPPPPGGKLPPPPPPPPGGKL-----PPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPP 543 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 49 PXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 P G+ G PP GG G PP PPPP GGG P Sbjct: 515 PPPGKAPPPPPGGKLPPPPPPGGK-GAPPPPPPPPGKLGPGGGPP 558 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAP 182 PP GG G PP PPP GGG P Sbjct: 530 PPPPPPGGKGAPPPPPPPPGKLGPGGGPP 558 >UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_43, whole genome shotgun sequence - Paramecium tetraurelia Length = 1401 Score = 48.4 bits (110), Expect = 3e-04 Identities = 24/60 (40%), Positives = 25/60 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP APPPP G G PPP PPP G P PP G K + P Sbjct: 830 PPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPP--PPPPGAKTGSAP 887 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP GG G PPP PPP G P Sbjct: 830 PPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPP 871 Score = 45.2 bits (102), Expect = 0.003 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP G GPPP PPP G Sbjct: 845 PPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPPG 880 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G PPPP G G PP PPP P P PP Sbjct: 861 PPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGGPRPPGPPPPPGGAPP 910 Score = 43.6 bits (98), Expect = 0.009 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPPP G G PP PPP GGP Sbjct: 861 PPPPGSKTGPPPPPPPPPPGAKTGSAPP--PPPPPGGP 896 Score = 40.7 bits (91), Expect = 0.064 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 6/48 (12%) Frame = -3 Query: 206 PPPPXXXXGX------PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP GG PPP PPP GG P Sbjct: 809 PPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPP 856 Score = 40.3 bits (90), Expect = 0.085 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = -1 Query: 205 PPPPXXXXGA------PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G+ PPPP G PPP PPP GG P PP Sbjct: 809 PPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPP 864 Score = 38.3 bits (85), Expect = 0.34 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP G PPP GG GP PPP G P P P Sbjct: 876 PPPPGAKTGSAPPPPPPPGGPRPPGP----PPPPGGAPPLPPGPRPPGGP 921 Score = 37.5 bits (83), Expect = 0.60 Identities = 24/75 (32%), Positives = 24/75 (32%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 GG G PPPP PPPP G P PP G Sbjct: 850 GGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPP-PGGPRPPGPPPPPG-- 906 Query: 136 GGPPPXPPPXXXGGP 92 G PP P P GGP Sbjct: 907 GAPPLPPGPRPPGGP 921 Score = 33.9 bits (74), Expect = 7.4 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP PP G P P S P Sbjct: 824 PPPP------PPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPP 871 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -1 Query: 175 PPPPXXXXGGG--XXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP GG PPP PPP GG P PP Sbjct: 808 PPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPP 849 >UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_34, whole genome shotgun sequence - Paramecium tetraurelia Length = 1131 Score = 48.4 bits (110), Expect = 3e-04 Identities = 22/49 (44%), Positives = 24/49 (48%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIP 59 PPPP GAPPPP G GGPPP PPP P P + +P Sbjct: 639 PPPPGGKTGAPPPPPPPPGA-KAGGPPPPPPPPGGKAPPL-PNAKPAVP 685 Score = 44.8 bits (101), Expect = 0.004 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPPP G GGPPP PPP P Sbjct: 639 PPPPGGKTGAPPPPPPPPGAKA-GGPPPPPPPPGGKAP 675 Score = 38.7 bits (86), Expect = 0.26 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Frame = -1 Query: 205 PPPPXXXXGA------PPPPXXXXGGGXXGGPPPXPPP--XXXGGPXFXP 80 PPPP PPPP GG G PPP PPP GGP P Sbjct: 618 PPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPP 667 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGG 201 PP GG G PP PPPP GG P GG Sbjct: 638 PPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPPGG 672 Score = 35.1 bits (77), Expect = 3.2 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP G G PPP P GGP P +P Sbjct: 632 PPPP------PPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPPGGKAP 675 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 PP G G PP PPPP GG P GG Sbjct: 637 PPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPPGG 672 >UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eutheria|Rep: Protein diaphanous homolog 2 - Homo sapiens (Human) Length = 1101 Score = 48.0 bits (109), Expect = 4e-04 Identities = 24/56 (42%), Positives = 26/56 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKL 38 PP P GAP PP G G PPP PPP GGP P +PP G+ L Sbjct: 566 PPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP-PPPPLGGVPPPPGISL 620 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PP P G P PP G G PPP PP GGP P Sbjct: 566 PPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPP 607 >UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 579 Score = 47.6 bits (108), Expect = 6e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG--PXFXPXXXEXNSPXXGP 45 PPPP G PPPP G PPP PPP GG P P P GP Sbjct: 365 PPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGP 420 Score = 46.8 bits (106), Expect = 0.001 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP G PPPP G PPP PPP GG P PP GL P Sbjct: 365 PPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGG---GPPPPPPPPPPPGLPGAGPP 421 Score = 46.4 bits (105), Expect = 0.001 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 1/80 (1%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G PPPP PPPP G PPPP G Sbjct: 357 GAPPPPPPPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLP 416 Query: 136 G-GPPPXPPPXXXGGPXFXP 80 G GPPP PPP G P P Sbjct: 417 GAGPPPPPPPPGCGPPPPPP 436 Score = 46.0 bits (104), Expect = 0.002 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXG-GPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G G GPPP PPP G P P P P Sbjct: 394 PPPPLPGGGPPPPPPPPPPPGLPGAGPPPPPPPPGCGPPPPPPMGSFGQKPENPP 448 Score = 39.5 bits (88), Expect = 0.15 Identities = 26/91 (28%), Positives = 29/91 (31%) Frame = -1 Query: 313 GGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXG 134 G PPPP PPPP GA PPP G Sbjct: 373 GPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGPPPPPPPPGC--- 429 Query: 133 GPPPXPPPXXXGGPXFXPXXRXVIPPSRGLK 41 GPPP PP G P + I P+ +K Sbjct: 430 GPPPPPPMGSFGQKPENPPRKPTIEPNCPMK 460 Score = 37.9 bits (84), Expect = 0.45 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 6/60 (10%) Frame = -3 Query: 206 PPPPXXXXGX------PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP GG G PPP PPP G P P P GP Sbjct: 376 PPPPPPLPGNTGAPPPPPPPPPLPGG---GPPPPPPPPPPPGLPGAGPPPPPP-PPGCGP 431 >UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1254 Score = 47.2 bits (107), Expect = 7e-04 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP G+ PPP GG GPPP PPP GP Sbjct: 511 PPPPPPPGGSVPPPPPLPGGTCSSGPPPPPPPPTSIGP 548 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPP GG GPPP PPP GP Sbjct: 511 PPPPPPPGGSVPPPPPLPGGTCSSGPPPPPPPPTSIGP 548 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 47.2 bits (107), Expect = 7e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP G PPPP G G GGPPP PP GG Sbjct: 968 PPPPPPGMGGPPPPPPPPGAGP-GGPPPPPPGASMGG 1003 Score = 44.8 bits (101), Expect = 0.004 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP-XXXGGPXFXP 80 PPPP G PPPP G G G PPP PPP GGP P Sbjct: 956 PPPPPPGVGGPPPPPPPPGMG--GPPPPPPPPGAGPGGPPPPP 996 Score = 44.4 bits (100), Expect = 0.005 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP--XXGGPXFXP 81 PPPP G PPPP G GGPPP PPP GGP P Sbjct: 956 PPPPPPGVGGPPPPPPPP---GMGGPPPPPPPPGAGPGGPPPPP 996 Score = 43.6 bits (98), Expect = 0.009 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP G G GGPPP P GG Sbjct: 968 PPPPPPGMGGPPPPPPPPGAG-PGGPPPPPPGASMGG 1003 Score = 39.5 bits (88), Expect = 0.15 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP G GGPPP PPP GGP P Sbjct: 953 PPPPP-----PPPP-------GVGGPPPPPPPPGMGGPPPPP 982 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G GGPPP PPP GGP P Sbjct: 954 PPPPPPPPG---VGGPPPPPPPPGMGGPPPPP 982 >UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1102 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/57 (40%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGG-PPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PPPP PPPP G GG PPP PPP GG P + P P A Sbjct: 583 PPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPGA 639 Score = 42.7 bits (96), Expect = 0.016 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PPPP G PPPP GG PP PPP GP P GP A Sbjct: 599 PPPPSGSGGAPPPPPPPPPPGGG---PPPPPPPPGSGPPPPPGAPPAPGAETGPKA 651 Score = 38.3 bits (85), Expect = 0.34 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 200 PPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PP PPPP G PPP PPP G P P GP Sbjct: 571 PPSPAAAPPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGP 622 Score = 38.3 bits (85), Expect = 0.34 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PP P PPPP G PPP PPP GG Sbjct: 571 PPSPAAAPPPPPPPPPLPGAEAPPPPPPPPPPSGSGG 607 Score = 37.9 bits (84), Expect = 0.45 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP G PPPP G G PPP PP Sbjct: 612 PPPPPPPGGGPPPPPPPPGSGPP--PPPGAPP 641 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 PP G GG PP PPP GG P G G Sbjct: 597 PPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSG 632 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 PP GG PP PPPP GG P G G Sbjct: 597 PPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSG 632 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GG P PPPP GGG P G G Sbjct: 596 PPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSG 632 >UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_104, whole genome shotgun sequence - Paramecium tetraurelia Length = 1152 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP--XXXGGPXFXPXXRXVIPP 56 PPPP G PPPP GGPPP PPP GGP P PP Sbjct: 633 PPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPPGAPQPP 684 Score = 44.8 bits (101), Expect = 0.004 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP--XXGGPXFXPXXXEXNSP 57 PPPP G PPPP GGPPP PPP GGP P P Sbjct: 633 PPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPPGAPQPP 684 Score = 39.5 bits (88), Expect = 0.15 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP GP P P GP Sbjct: 609 PPPPVKSAPLPPPPPPPK----IAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGP 658 Score = 39.1 bits (87), Expect = 0.20 Identities = 26/93 (27%), Positives = 28/93 (30%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP K P PP PPPP GG PPP Sbjct: 620 PPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPP-PPPPPPGSKAGGPPPPPPP 678 Query: 121 XPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXPS 23 P G P P ++GLK PS Sbjct: 679 GAPQPPGGSAPPPPFGAPPQPQNQGLKQKQNPS 711 Score = 38.3 bits (85), Expect = 0.34 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP P GGP P S GP Sbjct: 621 PPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGP--PPPPPPPGSKAGGP 672 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP G P P PP Sbjct: 609 PPPPVKSAPLPPPPPPPK---IAAPPPPPPPPMKAGPPPPPPPPGVPRPP 655 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXG 198 G PP G GGPP PPPP GG P G Sbjct: 641 GPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPPG 679 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 46.0 bits (104), Expect = 0.002 Identities = 30/99 (30%), Positives = 32/99 (32%), Gaps = 3/99 (3%) Frame = -1 Query: 313 GGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXG 134 G G PPPP PPPP G PPP GG Sbjct: 432 GVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAP-- 489 Query: 133 GPPPXPPPXXXGG---PXFXPXXRXVIPPSRGLKLTAXP 26 PPP PPP GG P F PP G+ + P Sbjct: 490 -PPPPPPPFPGGGVPPPPFPGGGPPPPPPIGGMGVPRLP 527 Score = 39.9 bits (89), Expect = 0.11 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP G G PPP PPP GG P Sbjct: 420 PPPP------PPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPP 455 Score = 39.9 bits (89), Expect = 0.11 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGG---PPPXPPPXXXGGPXFXP 80 PPP GAPPPP GG PPP PPP G P P Sbjct: 426 PPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPP 470 Score = 39.5 bits (88), Expect = 0.15 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP G G PPP PPP GG P Sbjct: 420 PPPP------PPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPP 455 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +1 Query: 97 PPXXGG----GXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 PP GG GG P PPPP GGG P GGG Sbjct: 472 PPFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGG 511 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP GGG PPP Sbjct: 489 PPPPPPPPFPGGGVPPPPFPGGGPPPPP 516 Score = 33.9 bits (74), Expect = 7.4 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -3 Query: 206 PPPPXXXXGX------PPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP GG PPP PPP GG Sbjct: 424 PPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPP--PPPGMGG 464 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPPP GG G P PP G P Sbjct: 503 PPPPFPGGGPPPPPPI----GGMGVPRLPGPPVASGPP 536 >UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 461 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXG--GGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP PPPP G GG PPP PPP GG P PP+ Sbjct: 281 PPPPPSDGSLPPPPPPPPGAPGGGAPPPPPPPPPAAAGGAGVPPPPPPPPPPA 333 Score = 45.2 bits (102), Expect = 0.003 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP G G G PPP PPP Sbjct: 281 PPPPPSDGSLPPPPPPPPGAPGGGAPPPPPPPP 313 Score = 41.1 bits (92), Expect = 0.049 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = -3 Query: 206 PPPPXXXXGX---PPPPXXXXGGGGXGGPPPXXPPP 108 PPPP G PPPP GG G PPP PPP Sbjct: 295 PPPPGAPGGGAPPPPPPPPPAAAGGAGVPPPPPPPP 330 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP G G PP PPPP GG G P Sbjct: 295 PPPPGAPGGGAPPPPPPPPPAAAGGAGVP 323 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 96 PPXXXGGGXGGG--PPXXPPPXXXXGGGGAP 182 PP G GGG PP PPP GG G P Sbjct: 293 PPPPPPGAPGGGAPPPPPPPPPAAAGGAGVP 323 >UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: diaphanous protein - Entamoeba histolytica HM-1:IMSS Length = 1176 Score = 45.6 bits (103), Expect = 0.002 Identities = 22/50 (44%), Positives = 23/50 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G PPPP G G PPP PPP G P P +PP Sbjct: 631 PPPPPGMPGMPPPPPPP---GMPGMPPPPPPPGMPGMPPPPPPGMPGMPP 677 Score = 42.3 bits (95), Expect = 0.021 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PPPP G G PPP PPP G P P Sbjct: 619 PPPPPGMPGMPPPPPPP---GMPGMPPPPPPPGMPGMPPPPP 657 Score = 42.3 bits (95), Expect = 0.021 Identities = 23/54 (42%), Positives = 25/54 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP G PPPP G G PPP PPP G P P + PP G+ Sbjct: 666 PPPPPGMPGMPPPPP-----GMPGMPPP-PPPGMPGMPPPPPGMPGMPPPPPGM 713 Score = 39.9 bits (89), Expect = 0.11 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP G G PPP PPP G P P Sbjct: 607 PPPPPGASSIPPPPPPP---GMPGMPPPPPPPGMPGMPPPPP 645 Score = 39.1 bits (87), Expect = 0.20 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G G PPP PP G P P P P Sbjct: 619 PPPPPGMPGMPPPPPPP---GMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPP 669 Score = 37.9 bits (84), Expect = 0.45 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP---PXXPPPXXGGPXFXP 81 PPPP G PPPP G PP P PPP G P P Sbjct: 643 PPPPPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPP 687 Score = 37.5 bits (83), Expect = 0.60 Identities = 23/60 (38%), Positives = 25/60 (41%), Gaps = 11/60 (18%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG------GGXGGPP-----PXXPPPXXGGPXFXPXXXEXNS 60 PPPP G PPPP G G G PP P PPP GG F P + N+ Sbjct: 676 PPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGGFGFRPAAPKPNA 735 Score = 37.1 bits (82), Expect = 0.79 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP-----PPXXXGGPXFXP 80 PPPP G PPPP G G PPP P PP GG F P Sbjct: 687 PPPPPGMPGMPPPPP-----GMPGMPPPPPGMPGMPPPPPGGFGFRP 728 Score = 36.7 bits (81), Expect = 1.0 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G G PPP PP G P P P P Sbjct: 607 PPPPPGASSIPPPPPPP---GMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPP 657 Score = 36.7 bits (81), Expect = 1.0 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXX-XXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G PPPP G G PPP PPP G P P + PP Sbjct: 642 PPPPPPGMPGMPPPPPPP---GMPGMPPP-PPPGMPGMPPPPPGMPGMPPP 688 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGP-PPXXPPPXXGGPXFXP 81 PPPP G PPPP G P P PPP G P P Sbjct: 666 PPPPPGMPGMPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPP 708 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGP--PPXPPPXXXGGPXFXP 80 PPPP G PPPP G P P PPP G P P Sbjct: 655 PPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPPGMPGMPP 698 Score = 34.3 bits (75), Expect = 5.6 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP PPPP G G PP PPP G P P + PP G Sbjct: 677 PPPPGMPGMPPPPPP-----GMPGMPP--PPPGMPGMPPPPPGMPGMPPPPPG 722 >UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF14700, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1204 Score = 45.6 bits (103), Expect = 0.002 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = -1 Query: 313 GGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXG 134 GG PPPP PPPP GA PPP G Sbjct: 605 GGVPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAG 664 Query: 133 GPPPXPPPXXXGGPXFXP 80 PPP PPP GP P Sbjct: 665 PPPPPPPPLSGAGPPPPP 682 Score = 42.3 bits (95), Expect = 0.021 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG-GPXFXP 81 PPPP G PPPP G GPPP PPP G GP P Sbjct: 630 PPPPPSAAGLPPPPPPPLPG---AGPPPPPPPPLPGAGPPPPP 669 Score = 39.1 bits (87), Expect = 0.20 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG-GPXFXP 81 PPPP PPPP G GPPP PPP G GP P Sbjct: 642 PPPPPLPGAGPPPPPPPPLPG--AGPPPPPPPPLSGAGPPPPP 682 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG---GGXGGPPPXXPPP 108 PPPP G PPPP G G PPP PPP Sbjct: 598 PPPPPALGGVPPPPPPPPPPPALGAMGAPPPPPPPP 633 Score = 37.9 bits (84), Expect = 0.45 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP G PPPP G GPPP PP Sbjct: 656 PPPPLPGAGPPPPPPPPLSGA---GPPPPPP 683 Score = 37.5 bits (83), Expect = 0.60 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP G GPPP PPP G Sbjct: 656 PPPPLPGAGPPPPPPPPLSG---AGPPP--PPPMPG 686 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP G PPPP PPP P P G P P P P Sbjct: 616 PPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPPPPP 669 Score = 33.9 bits (74), Expect = 7.4 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 P APPPP GG PPP PPP G P P + GL Sbjct: 589 PASDVCDSAPPPPPAL--GGVPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGL 639 >UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2; Vibrio harveyi|Rep: Insecticidal toxin, SepC/Tcc class - Vibrio harveyi HY01 Length = 378 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP-PXXPPPXXGGPXFXPXXXE 69 PPPP G PPPP GGG PP P PPP G P E Sbjct: 93 PPPPPPAGGMPPPPPPPMGGGAPPPPPGPGAPPPPPGAKKAAPVDDE 139 Score = 44.8 bits (101), Expect = 0.004 Identities = 25/58 (43%), Positives = 25/58 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTA 32 PPPP APPPP G G PPP PPP G P P PP G K A Sbjct: 82 PPPPPPPRMAPPPPPPPAG----GMPPPPPPPMGGGAPP-PPPGPGAPPPPPGAKKAA 134 Score = 36.3 bits (80), Expect = 1.4 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP PPPP GG PP PPP GG P P G Sbjct: 82 PPPPPPPRMAPPPPPPP-----AGGMPPPPPPPMGGGAPPPPPGPGAPPPPPG 129 >UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 1705 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/60 (38%), Positives = 24/60 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPPP G GGPPP PPP G P PP G + P Sbjct: 984 PPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPP--PPMPGAPIPPPP 1041 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIP 59 PPP G PPPP G GG PP PPP G P P +P Sbjct: 999 PPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPPPMPGAPIPPPPGAPPLP 1047 Score = 44.0 bits (99), Expect = 0.007 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP PPPP G GGPPP PPP G Sbjct: 984 PPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPPPLPG 1019 Score = 42.3 bits (95), Expect = 0.021 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP G PPPP G GG PP PPP G P P Sbjct: 999 PPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPPPMPGAPIPPP 1040 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 G PP G GG PP PPPP GG P Sbjct: 993 GPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPP 1026 >UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila melanogaster|Rep: Protein cappuccino - Drosophila melanogaster (Fruit fly) Length = 1059 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/52 (40%), Positives = 22/52 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSR 50 PPPP GAPPPP G PPP P P GG P PS+ Sbjct: 510 PPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSK 561 Score = 43.2 bits (97), Expect = 0.012 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP G G PPP P P GG P Sbjct: 510 PPPPLANYGAPPPPPPPPPGSG-SAPPPPPPAPIEGGGGIPP 550 Score = 39.5 bits (88), Expect = 0.15 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP GGG G PPP PPP P Sbjct: 525 PPPPGSGSAPPPPPPAPIEGGG-GIPPP--PPPMSASP 559 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP PPPP G PPP PPP G Sbjct: 500 PPPPPPPPPPPPPPL-----ANYGAPPPPPPPPPGSG 531 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP PPPP G PPP PPP G Sbjct: 500 PPPPPPPPPPPPPPL-----ANYGAPPPPPPPPPGSG 531 Score = 27.5 bits (58), Expect(2) = 2.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 236 PPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPP G PPP Sbjct: 500 PPPPPPPPPPPPPPLANYGAPPPPPPP 526 Score = 26.6 bits (56), Expect(2) = 2.7 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 233 PPPPPPPP 256 PPPPPPPP Sbjct: 485 PPPPPPPP 492 >UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: actin binding protein - Entamoeba histolytica HM-1:IMSS Length = 986 Score = 45.2 bits (102), Expect = 0.003 Identities = 24/56 (42%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = -1 Query: 205 PPPPXXXX--GAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP G PPPP G G PPP PPP G P P +PP GL Sbjct: 504 PPPPGTQPIPGVPPPPPGVPGA--TGVPPPPPPPGMPGAPPPPPPMGKGMPPPPGL 557 Score = 37.9 bits (84), Expect = 0.45 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP G PPPP G G PPP PP G P P + P G Sbjct: 504 PPPPGTQPIPGVPPPPPGVPGATGV--PPPPPPPGMPGAPPPPPPMGKGMPPPPG 556 >UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 534 Score = 45.2 bits (102), Expect = 0.003 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 1/87 (1%) Frame = -1 Query: 310 GGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGG 131 G PPPP PPPP GAPPPP GG Sbjct: 323 GAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSR--GAPPPPSMGMAPPPVGG 380 Query: 130 P-PPXPPPXXXGGPXFXPXXRXVIPPS 53 PP PPP GGP P PPS Sbjct: 381 AAPPPPPPPPVGGPPPPPPPIEGRPPS 407 Score = 40.7 bits (91), Expect = 0.064 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG--GGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP G G PPP PPP G P P Sbjct: 385 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPP-PPPGRGAPPPGP 427 Score = 40.7 bits (91), Expect = 0.064 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGG--GXXGGPPPXPPPXXXGGP 92 PPPP G PPPP G G PPP PPP P Sbjct: 385 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 424 Score = 39.5 bits (88), Expect = 0.15 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG---GGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP G PPPP GG PPP PPP GGP P E P Sbjct: 358 PPPPSR--GAPPPPSMGMAPPPVGGAAPPPP--PPPPVGGPPPPPPPIEGRPP 406 Score = 34.7 bits (76), Expect = 4.2 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = -1 Query: 205 PPPPXXXXGAPPPP--XXXXGGGXXGGPPPXPPPXXXGGPXFXPXXR---XVIPPSRG 47 PPPP APPPP G PP PP P P R PPSRG Sbjct: 307 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRG 364 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP PPPP GG PP PP G P +P GP Sbjct: 375 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 427 >UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; Ajellomyces capsulatus NAm1|Rep: Putative uncharacterized protein - Ajellomyces capsulatus NAm1 Length = 1481 Score = 45.2 bits (102), Expect = 0.003 Identities = 19/33 (57%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXG-GGXXGGPPPXPPP 110 PPPP APPPP GG GGPPP PPP Sbjct: 1399 PPPPAFSAAAPPPPPPPPPVGGAPGGPPPPPPP 1431 Score = 41.5 bits (93), Expect = 0.037 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP PPPP GG GGPPP PPP P Sbjct: 1400 PPPAFSAAAPPPPPPPPPVGGAPGGPPPP-PPPAGDAP 1436 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = -1 Query: 205 PPPPXXXXGAPP---PPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PP P APP PP PPP PPP G P P Sbjct: 1382 PPVPAPFADAPPTAPPPPPPPAFSAAAPPPPPPPPPVGGAPGGPP 1426 >UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whole genome shotgun sequence; n=7; Euteleostomi|Rep: Chromosome undetermined SCAF14625, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 496 Score = 44.8 bits (101), Expect = 0.004 Identities = 24/60 (40%), Positives = 25/60 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP GAPPPP G G PPP PP P PP+R L A P Sbjct: 277 PPPPPGRGGAPPPPPPPPARGSRGAPPPPPPSRAPASAPPPP------PPTRPGSLGAPP 330 Score = 43.6 bits (98), Expect = 0.009 Identities = 20/50 (40%), Positives = 22/50 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP + PPP G G PPP PPP GG P + PP Sbjct: 304 PPPPSRAPASAPPPPPPTRPGSLGAPPP-PPPTTRGGHQVAPPHQKTPPP 352 Score = 40.7 bits (91), Expect = 0.064 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP G PPPP G G PPP PPP Sbjct: 277 PPPPPGRGGAPPPPPPPPARGSRGAPPP--PPP 307 Score = 37.1 bits (82), Expect = 0.79 Identities = 21/60 (35%), Positives = 23/60 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYSXT 27 PPPP PPP G G PPP PP GG P +P P + S T Sbjct: 304 PPPPSRAPASAPPPPPPTRPGSLGAPPP-PPPTTRGGHQVAP--PHQKTPPPPPQSSSHT 360 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPP GAPPPP PPP P G P P Sbjct: 292 PPPARGSRGAPPPPPPSRAPASAPPPPPPTRPGSLGAPPPPP 333 >UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing protein; n=2; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1139 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G PPP PPP G P P IPP Sbjct: 590 PPPPPGASLVPPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPP 639 Score = 41.9 bits (94), Expect = 0.028 Identities = 22/56 (39%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG--PXFXPXXRXVIPPSRGL 44 PPPP PPPP G PPP PPP GG P P + PP G+ Sbjct: 591 PPPPGASLVPPPPPPPPGAAGLV--PPPPPPPPGAGGIPPPPPPPGAGIPPPPPGV 644 Score = 41.9 bits (94), Expect = 0.028 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = -3 Query: 206 PPPPXXXXG-XPPPPXXXXGGGGXGGPPP----XXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G GG PPP PPP G P P P P Sbjct: 603 PPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPPGAPGLPPPPP 661 Score = 41.9 bits (94), Expect = 0.028 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G G G PP PPP G P P + PP Sbjct: 604 PPPPGAAGLVPPPPPPPPGAG---GIPPPPPPPGAGIPPPPPGVPGIPPP 650 Score = 41.5 bits (93), Expect = 0.037 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG-GPXFXPXXRXVIPP 56 PPPP G PPP G PPP PPP G P P ++PP Sbjct: 537 PPPPPPPPGLVPPPPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPP 587 Score = 40.7 bits (91), Expect = 0.064 Identities = 23/60 (38%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP--PXPPPXXXGGPXFXPXXRXVIPPSRGLKLTA 32 PPPP G PPPP G G P P PPP G P P + PP G++ A Sbjct: 628 PPPPPPGAGIPPPPPGVPGIPPPPGAPGLPPPPPGVPGIPP-PPGAPGLPPPPPGMRRNA 686 Score = 40.3 bits (90), Expect = 0.085 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP PPPP G G PPP PPP GG Sbjct: 590 PPPPPGASLVPPPPPPPPGAAGLV-PPPPPPPPGAGG 625 Score = 38.7 bits (86), Expect = 0.26 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP--PXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G G PP P PPP G P P P P Sbjct: 628 PPPPPPGAGIPPPPP---GVPGIPPPPGAPGLPPPPPGVPGIPPPPGAPGLPPPPP 680 Score = 37.5 bits (83), Expect = 0.60 Identities = 25/90 (27%), Positives = 26/90 (28%), Gaps = 3/90 (3%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGG--- 146 G G PPP PPPP G PPPP G Sbjct: 580 GAAGLVPPPPPPPPPGASLVPPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPP 639 Query: 145 GXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 G P PPP G P P + PP Sbjct: 640 PPPGVPGIPPPPGAPGLPPPPPGVPGIPPP 669 Score = 36.3 bits (80), Expect = 1.4 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG---GPXFXPXXRXVIPP 56 PPP PPPP G PPP PPP G P P IPP Sbjct: 577 PPPGAAGLVPPPPPPPPPGASLVPPPPPPPPGAAGLVPPPPPPPPGAGGIPP 628 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPP G PPP PP G P P Sbjct: 537 PPPPPPPPGLVPPPPPPPPGASLVPPPPPPPP---GAPGLVP 575 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G PPP P P ++PP Sbjct: 552 PPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPPPPPPPPPGASLVPP 601 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 P PP G PPP G PPP PPP G Sbjct: 575 PSPPPGAAGLVPPPPPPPPPGASLVPPPPPPPPGAAG 611 Score = 33.5 bits (73), Expect = 9.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP G G PPP Sbjct: 561 PPPPPPPPGAPGLVPSPPPGAAGLVPPP 588 >UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 9.t00033 - Entamoeba histolytica HM-1:IMSS Length = 540 Score = 44.4 bits (100), Expect = 0.005 Identities = 26/62 (41%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = -1 Query: 205 PPPPXXXXGA--PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTA 32 PPPP G PPPP G G G PPP PPP G P PP+RG A Sbjct: 372 PPPPAFDTGCGVPPPPPPARGTGC-GAPPPPPPPAFDTGCGIPPPP----PPARGTGCGA 426 Query: 31 XP 26 P Sbjct: 427 PP 428 Score = 37.5 bits (83), Expect = 0.60 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP PPPP G G G PP PPP P Sbjct: 427 PPPPPPLNAPPPPPPPAHGTGC--GVPPPPPPSLNNPP 462 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 206 PPPPXXXXGXP-PPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPP G G G PPP PP G P Sbjct: 372 PPPPAFDTGCGVPPPPPPARGTGCGAPPPPPPPAFDTGCGIPP 414 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP G G G PPP PPP P Sbjct: 427 PPPPPPLNAPPPPPPPAH-GTGCGVPPP--PPPSLNNP 461 Score = 36.7 bits (81), Expect = 1.0 Identities = 23/57 (40%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Frame = -3 Query: 206 PPPPXXXXGX--PPPPXXXXGGGGXGGPPPXXPPPXXG-GPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G G PPP PPP G G P N+P P Sbjct: 386 PPPPARGTGCGAPPPPPPPAFDTGCGIPPP--PPPARGTGCGAPPPPPPLNAPPPPP 440 Score = 35.1 bits (77), Expect = 3.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -1 Query: 205 PPPPXXXXGA--PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PPPP G G G PP PPP P P Sbjct: 401 PPPPAFDTGCGIPPPPPPARGTGC--GAPPPPPPLNAPPPPPPP 442 Score = 34.7 bits (76), Expect = 4.2 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 205 PPPPXXXXG--APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G APPPP G PPP PP G P PP Sbjct: 386 PPPPARGTGCGAPPPPPPPAFDTGCGIPPPPPPARGTGCGAPPPPPPLNAPP 437 >UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1074 Score = 44.4 bits (100), Expect = 0.005 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 9/63 (14%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG-GGXGGPPPXXPPPXXGG--------PXFXPXXXEXNSPX 54 PPPP G PPPP G G PPP PPP GG P P + N P Sbjct: 575 PPPPISGGGAPPPPPPPPPPPSGGGAPPPPPPPPPSGGKKAGAPGAPPTGPAAIQPNKPV 634 Query: 53 XGP 45 P Sbjct: 635 INP 637 Score = 43.6 bits (98), Expect = 0.009 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP GAPPPP GG PP PPP G Sbjct: 575 PPPPISGGGAPPPPPPPPPPPSGGGAPPPPPPPPPSG 611 Score = 39.9 bits (89), Expect = 0.11 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 4/59 (6%) Frame = -1 Query: 196 PXXXXGAPPP----PXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTA 32 P GAPPP P GGG PPP PPP GG P PPS G K A Sbjct: 562 PISGGGAPPPSPSPPPPISGGGAPPPPPPPPPPPSGGG---APPPPPPPPPSGGKKAGA 617 Score = 37.1 bits (82), Expect = 0.79 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = -1 Query: 205 PPPPXXXXGA-----PPPPXXXXGGGXXGGPPPXPPPXXXGG 95 P PP G PPPP GG G PPP PPP GG Sbjct: 573 PSPPPPISGGGAPPPPPPPPPPPSGG--GAPPPPPPPPPSGG 612 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPP PPPP GGG PPP PPP GG Sbjct: 569 PPPSPS---PPPPIS--GGGAPPPPPPPPPPPSGGG 599 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP GG G PP PPPP GGG P Sbjct: 576 PPPISGG---GAPPPPPPPPPPPSGGGAP 601 Score = 34.3 bits (75), Expect = 5.6 Identities = 23/59 (38%), Positives = 25/59 (42%), Gaps = 4/59 (6%) Frame = -1 Query: 205 PPPPXX---XXGA-PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLK 41 PPPP GA PPPP GG G P PP GP + VI PS +K Sbjct: 588 PPPPPPPPSGGGAPPPPPPPPPSGGKKAGAPGAPPT----GPAAIQPNKPVINPSSKMK 642 >UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding; n=1; Yarrowia lipolytica|Rep: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding - Yarrowia lipolytica (Candida lipolytica) Length = 1851 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/35 (54%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXG---GGXXGGPPPXPPP 110 PPPP G PPPP G G GGPPP PPP Sbjct: 1072 PPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPP 1106 Score = 42.7 bits (96), Expect = 0.016 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXG---GGGXGGPPPXXPPP 108 PPPP G PPPP G G GGPPP PPP Sbjct: 1072 PPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPPP 1107 Score = 40.7 bits (91), Expect = 0.064 Identities = 22/54 (40%), Positives = 23/54 (42%), Gaps = 6/54 (11%) Frame = -1 Query: 199 PPXXXXGAPPPPXXXXGGGXXGGPPP------XPPPXXXGGPXFXPXXRXVIPP 56 PP G PPPP G GGPPP PPP GGP P +PP Sbjct: 1059 PPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPP-PPPPPPPLPP 1111 Score = 39.5 bits (88), Expect = 0.15 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPP G PPPP GG PPP PP GGP Sbjct: 1082 PPPPGFTGGPPPP-GFTGGPPPPPPPPPLPPGFTGGP 1117 Score = 39.1 bits (87), Expect = 0.20 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPPP GG PPP PP GGP Sbjct: 1082 PPPPGFTGGPPPP-GFTGGPPPPPPPPPLPPGFTGGP 1117 Score = 37.5 bits (83), Expect = 0.60 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXX-GGGXXGGPPPXPPPXXXGGPXFXPXXRXVIP 59 PPPP G PPPP G GGPPP P P G P +P Sbjct: 1091 PPPPGFTGGPPPPPPPPPLPPGFTGGPPP-PAPAFVAGATPSPSPSPQLP 1139 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP PPP G PPP PPP GGP Sbjct: 1048 PPPPPPMFTGGPPPMFT---GGPPPPPPPPPPGFTGGP 1082 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP G PPP GG PPP PP G P Sbjct: 1049 PPPPPMFTGGPPPMFT---GGPPPPPPPPPPGFTGGPP 1083 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPP-----XXPPPXXGGPXFXP 81 PPP G PPPP G G PPP PP GGP P Sbjct: 1059 PPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPP 1104 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 206 PPPPXXXXG-XPPPPXXXXGGGGXGGPPPXXP 114 PPPP G PPPP G GGPPP P Sbjct: 1091 PPPPGFTGGPPPPPPPPPLPPGFTGGPPPPAP 1122 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPP GG PPP PP GGP Sbjct: 1048 PPPPPPMFTGGPPPMFT---GGPPPPPPPPPPGFTGGP 1082 Score = 33.5 bits (73), Expect = 9.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP GG PPP Sbjct: 1046 PPPPPPPPMFTGGPPPMFTGGPPPPPPP 1073 Score = 27.1 bits (57), Expect(2) = 5.7 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 651 GGXXPPXPXPPPP 689 GG PP P PPPP Sbjct: 1041 GGPPPPPPPPPPP 1053 Score = 25.8 bits (54), Expect(2) = 5.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 663 PPXPXPPPPP 692 PP P PPPPP Sbjct: 1067 PPPPPPPPPP 1076 >UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|Rep: Diaphanous homologue - Gallus gallus (Chicken) Length = 1253 Score = 44.0 bits (99), Expect = 0.007 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP--PXXGGPXFXP 81 PPPP PPPP GG G PPP PP P G F P Sbjct: 726 PPPPLFGGAVPPPPPLPGGGAGPPPPPPGGPPMAPSLGSYPFAP 769 Score = 42.3 bits (95), Expect = 0.021 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPP GGG GPPP PPP GGP P Sbjct: 725 PPPPPLFGGAVPPPPPLPGGG--AGPPP--PPP--GGPPMAP 760 Score = 40.3 bits (90), Expect = 0.085 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP G PPP GG PPP P P GP P + PS G Sbjct: 714 PPPPPLPGGTIPPPPPLFGGAV---PPPPPLPGGGAGPPPPPPGGPPMAPSLG 763 Score = 34.3 bits (75), Expect = 5.6 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 205 PPPPXXXXGAP--PPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP GA PPP GG PPP P P P IPP Sbjct: 675 PPPPPLPGGAAVIPPPPLLPGGTVIPPPPPLPGGAAAVLPPPPPLPGGTIPP 726 >UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.21; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein T7P1.21 - Arabidopsis thaliana (Mouse-ear cress) Length = 907 Score = 44.0 bits (99), Expect = 0.007 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP AP PP G GGPPP PPP Sbjct: 565 PPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPP 596 Score = 41.5 bits (93), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPPP P PP G G GGPPP PP Sbjct: 565 PPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPP 596 Score = 39.5 bits (88), Expect = 0.15 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP PPP P NS GP Sbjct: 539 PPPPPGTAAAPPPPPPPPGT--QAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGP 590 Score = 38.7 bits (86), Expect = 0.26 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP A PPP G PPP PPP P P Sbjct: 538 PPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Score = 38.3 bits (85), Expect = 0.34 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP APPPP G PPP PPP P P Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAA-APPPPPPPPGTQAAPPPPP 566 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP PPP G G PPP PP G Sbjct: 566 PPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANG 602 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP P P P + +P P Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP A PPP PPP PPP P P Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPP 553 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPP G PPP PP P P N P Sbjct: 525 PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPP 578 >UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; Dictyostelium discoideum|Rep: Wiscott-Aldrich syndrome protein - Dictyostelium discoideum AX4 Length = 399 Score = 44.0 bits (99), Expect = 0.007 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 6/59 (10%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXG------GGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP APPPP G PPP PPP GP P PPS G Sbjct: 264 PPPPSVGKSAPPPPPPSHKTPAAPPSGGGAPPPPPPPPPPSSGPPPPPPPMASAPPSSG 322 Score = 39.5 bits (88), Expect = 0.15 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 6/59 (10%) Frame = -3 Query: 206 PPPPXXXXGXPPPP------XXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP PPPP GG PPP PPP GP P P G Sbjct: 264 PPPPSVGKSAPPPPPPSHKTPAAPPSGGGAPPPPPPPPPPSSGPPPPPPPMASAPPSSG 322 >UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Diaphanous - Aedes aegypti (Yellowfever mosquito) Length = 1014 Score = 44.0 bits (99), Expect = 0.007 Identities = 22/54 (40%), Positives = 23/54 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G GG G PPP PP G P P +P P Sbjct: 432 PPPPQMPGMGPPPPPPPPGSGG-GMPPPPPPPMMPGVPMPPPMPGMGGAPRPPP 484 Score = 36.3 bits (80), Expect = 1.4 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 5/54 (9%) Frame = -1 Query: 205 PPPPXXXXGAP-PPPXXXXGGGXXGGP----PPXPPPXXXGGPXFXPXXRXVIP 59 PPPP G P PPP GG P P PPP GP P +IP Sbjct: 458 PPPPPMMPGVPMPPPMPGMGGAPRPPPMPGMGPPPPPMPGMGPPRPPGMPGMIP 511 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -3 Query: 206 PPPPXXXXGXP-PPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G P PPP GG P P PP P P Sbjct: 458 PPPPPMMPGVPMPPPMPGMGGAPRPPPMPGMGPPPPPMPGMGP 500 Score = 33.9 bits (74), Expect = 7.4 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 3/58 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP---PPXXXGGPXFXPXXRXVIPPSRGLK 41 PPP GAP PP G PPP P PP G P P P GLK Sbjct: 470 PPPMPGMGGAPRPPPMP---GMGPPPPPMPGMGPPRPPGMPGMIPMAPMPAPLPHGLK 524 >UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 757 Score = 44.0 bits (99), Expect = 0.007 Identities = 24/60 (40%), Positives = 25/60 (41%), Gaps = 6/60 (10%) Frame = +1 Query: 46 GPXXGELXSXLXGXXXGPPXXGGGXXGGGPP------XPPPPXXXXGGGGXPXXXXGGGG 207 GP G + G GPP GGG GGG P P GGGG P GGGG Sbjct: 334 GPAGGRVPPASGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGG 393 Score = 40.7 bits (91), Expect = 0.064 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPP---XXPPPXXXXGGGGAPXXXXGGGG 206 G GPP GGG GGGPP PP GGGG GGGG Sbjct: 389 GGGGGPPGGGGGG-GGGPPGGGGGGPPGSGGGGGGGGGPPEGGGG 432 Score = 39.1 bits (87), Expect = 0.20 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G GPP GGG GGG P P G GAP GGGG Sbjct: 408 GGGGGPPGSGGGGGGGGGP----PEGGGGSDGAPGRGGGGGG 445 Score = 38.7 bits (86), Expect = 0.26 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPX-----PPPPXXXXGGGGXPXXXXGGGG 207 G G P GGG GGGPP PP GGGG P GGGG Sbjct: 388 GGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGP--PEGGGG 432 Score = 37.9 bits (84), Expect = 0.45 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXX----PPPXXXXGGGGAPXXXXGGG 203 G G P GGG GGGPP PP GGGG GGG Sbjct: 388 GGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGG 432 Score = 37.1 bits (82), Expect = 0.79 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXP--------PPPXXXXGGGGXPXXXXGGGG 207 G GPP GGG GGG P P GGGG P GGGG Sbjct: 408 GGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGGG 457 Score = 36.7 bits (81), Expect = 1.0 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 6/48 (12%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPP------XXPPPXXXXGGGGAPXXXXGGGG 206 G GPP GGG GGGPP PP GGGG P GGGG Sbjct: 379 GGGGGPPG--GGGGGGGPPGGGGGGGGGPP---GGGGGGPPGSGGGGG 421 Score = 36.3 bits (80), Expect = 1.4 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPP-----PPXXXXGGGGXPXXXXGGG 204 G G P GGG GGGPP PP GGGG P GGG Sbjct: 369 GGSDGAPGRGGG--GGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGG 412 Score = 35.9 bits (79), Expect = 1.8 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = +1 Query: 82 GXXXGPPXXGGGXXG----GGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G GPP GGG G GG PP GGGG P GGGG Sbjct: 359 GGGGGPPEGGGGSDGAPGRGGGGGGPPGGG-GGGGGPPGGGGGGGG 403 Score = 35.5 bits (78), Expect = 2.4 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = +1 Query: 82 GXXXGPPXXGGG----XXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G GPP GGG GGG PP GGGG P GGGG Sbjct: 379 GGGGGPPGGGGGGGGPPGGGGGGGGGPP--GGGGGGPPGSGGGGGG 422 Score = 34.7 bits (76), Expect = 4.2 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGP----PXXPPPXXXXGGGGAPXXXXGGGG 206 G G P GGG G P PP GGGG P GGGG Sbjct: 358 GGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPGGGGGGGG 403 >UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os03g0308700 protein - Oryza sativa subsp. japonica (Rice) Length = 464 Score = 43.6 bits (98), Expect = 0.009 Identities = 29/97 (29%), Positives = 31/97 (31%) Frame = -1 Query: 313 GGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXG 134 G PPPP PPPP PPPP G Sbjct: 260 GEWLPPPPSTPPRWTRSPTPPPPPPSPPHATPPPPPPPPPREMVAPPPPPPPPYYGQPTL 319 Query: 133 GPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXPS 23 PPP PPP G P P +PP R L A P+ Sbjct: 320 APPPPPPPPYCGHPTLAP-----LPP-RPLHFGASPA 350 >UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1561 Score = 43.6 bits (98), Expect = 0.009 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G GPPP PPP G P + P P Sbjct: 1037 PPPPPISGAPPPPPPPPPPMKGGAGPPPPPPPPGKLGAKKPPAGVQCRPPPKVP 1090 Score = 42.7 bits (96), Expect = 0.016 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXG-GPPPXPPPXXXGGPXFXPXXRXVIPPSR 50 PPPP GAPPPP G GPPP PPP G P PP + Sbjct: 1036 PPPPPPISGAPPPPPPPPPPMKGGAGPPPPPPPPGKLGAKKPPAGVQCRPPPK 1088 >UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: Formin A - Trypanosoma cruzi strain CL Brener Length = 1178 Score = 43.6 bits (98), Expect = 0.009 Identities = 29/100 (29%), Positives = 29/100 (29%), Gaps = 6/100 (6%) Frame = -1 Query: 307 GXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGA------PPPPXXXXGG 146 G PPPP PPPP GA PPPP G Sbjct: 552 GLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGA 611 Query: 145 GXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 G G PP PPP G PP G K P Sbjct: 612 GAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPP 651 Score = 43.2 bits (97), Expect = 0.012 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 4/64 (6%) Frame = -1 Query: 205 PPPPXXXXGA----PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKL 38 PPPP GA PPPP G G G PP PPP G PP G K Sbjct: 524 PPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKS 583 Query: 37 TAXP 26 P Sbjct: 584 GLPP 587 Score = 41.1 bits (92), Expect = 0.049 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 6/77 (7%) Frame = -1 Query: 307 GXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGA------PPPPXXXXGG 146 G PPPP PPPP GA PPPP G Sbjct: 584 GLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGA 643 Query: 145 GXXGGPPPXPPPXXXGG 95 G G PP PPP G Sbjct: 644 GAKSGLPPPPPPPPGAG 660 Score = 40.7 bits (91), Expect = 0.064 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP G G G PP PPP G Sbjct: 526 PPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAG 564 Score = 40.7 bits (91), Expect = 0.064 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP G G G PP PPP G Sbjct: 542 PPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAG 580 Score = 40.7 bits (91), Expect = 0.064 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP G G G PP PPP G Sbjct: 558 PPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAG 596 Score = 40.7 bits (91), Expect = 0.064 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP G G G PP PPP G Sbjct: 574 PPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAG 612 Score = 40.7 bits (91), Expect = 0.064 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP G G G PP PPP G Sbjct: 590 PPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAG 628 Score = 40.7 bits (91), Expect = 0.064 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP G G G PP PPP G Sbjct: 606 PPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAG 644 Score = 40.7 bits (91), Expect = 0.064 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP G G G PP PPP G Sbjct: 622 PPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAG 660 Score = 38.7 bits (86), Expect = 0.26 Identities = 28/96 (29%), Positives = 28/96 (29%), Gaps = 12/96 (12%) Frame = -1 Query: 307 GXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGA------PPPPXXXXGG 146 G PPPP PPPP GA PPPP G Sbjct: 600 GLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGA 659 Query: 145 GXXGG------PPPXPPPXXXGGPXFXPXXRXVIPP 56 G G PPP PPP G P PP Sbjct: 660 GAKSGLSPPPPPPPPPPPPGAGAKSGLPPPPPPPPP 695 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGGGXGG--PPPXXPPP 108 PPPP G PPPP G G G PPP PPP Sbjct: 638 PPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPPPPPP 674 Score = 36.7 bits (81), Expect = 1.0 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP G G PPP PPP G P PP G K P Sbjct: 523 PPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPP-PPGAGAKSGLPP 571 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP G G G PP PPP Sbjct: 667 PPPP------PPPPPPPPGAGAKSGLPPPPPPP 693 Score = 34.7 bits (76), Expect = 4.2 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 14/86 (16%) Frame = -1 Query: 307 GXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGA-----------PPPPX 161 G PPPP PPPP GA PPPP Sbjct: 616 GLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPPPPPPP 675 Query: 160 XXXGGGXXGG---PPPXPPPXXXGGP 92 G G G PPP PPP P Sbjct: 676 PPPGAGAKSGLPPPPPPPPPKAKSRP 701 Score = 34.3 bits (75), Expect = 5.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G G G PP PPP G Sbjct: 522 PPPPPPPPGAGAKSGLPPPPPPPPGAG 548 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 43.6 bits (98), Expect = 0.009 Identities = 21/58 (36%), Positives = 22/58 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PP P G PPP GPPP PP G P P E P GP +S Sbjct: 230 PPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPPPHGPPPHFPPPAEGPPPPHGPPPHS 287 Score = 43.2 bits (97), Expect = 0.012 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP G GPPP PPP G P Sbjct: 143 PPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPP 180 Score = 40.7 bits (91), Expect = 0.064 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G GPPP PP G P P +PP Sbjct: 143 PPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPP---PVAGPPVPP 189 Score = 39.9 bits (89), Expect = 0.11 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP PPP P P + P P Sbjct: 144 PPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEP 197 Score = 39.5 bits (88), Expect = 0.15 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXX-PPPXXGGPXFXPXXXEXNSPXXGP 45 PPP G PPP G PPP PPP G P P E P GP Sbjct: 246 PPPAPPVEGPPPPHSPPPHGPPPHFPPPAEGPPPPHGPPPHSPPPSEGPPPPHGP 300 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP PPPP G PPP PPP P P Sbjct: 139 PPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGP 179 Score = 34.7 bits (76), Expect = 4.2 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 P PP PPPP G PPP PP GP P P GP Sbjct: 190 PHPPPAEPAPPPPPAPQ----GPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGP 239 Score = 34.7 bits (76), Expect = 4.2 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G GPPP P P P + P GP Sbjct: 217 PPPPK---GPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPH-SPPPHGP 266 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP G PPP PP P Sbjct: 163 PPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPP 200 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G PP P G GPPP P P P +PP Sbjct: 199 PPPPPAPQG-PPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPP 247 >UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pombe|Rep: Formin-3 - Schizosaccharomyces pombe (Fission yeast) Length = 1461 Score = 43.6 bits (98), Expect = 0.009 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPP G PPPP G G G PPP PPP Sbjct: 752 PPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 38.7 bits (86), Expect = 0.26 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXG-GGXXGGPPPXPPPXXXGG 95 PPP G PPPP G G PPP PPP G Sbjct: 752 PPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAG 788 Score = 33.5 bits (73), Expect = 9.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGG 177 PP G G GPP PPPP GG Sbjct: 763 PPPPPPGVAGAGPPPPPPPPPAVSAGG 789 >UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein cappuccino; n=1; Apis mellifera|Rep: PREDICTED: similar to Protein cappuccino - Apis mellifera Length = 1007 Score = 43.2 bits (97), Expect = 0.012 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP GGPPP PPP P Sbjct: 458 PPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTP 495 Score = 38.3 bits (85), Expect = 0.34 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -1 Query: 205 PPPPXXXXGA----PPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP G PPPP GG PPP PPP G Sbjct: 490 PPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPPPPPPPPG 530 Score = 37.5 bits (83), Expect = 0.60 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -3 Query: 206 PPPPXXXXG----XPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP GG PPP PPP G Sbjct: 490 PPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPPPPPPPPG 530 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP GGG PPP Sbjct: 460 PPPPPPPPPPPPPPTQSSAAGGGPPPPP 487 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP GGG PPP Sbjct: 461 PPPPPPPPPPPPPTQSSAAGGGPPPPPP 488 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP--PPXXGGPXFXP 81 PPPP PPP GGG PPP P P G P P Sbjct: 461 PPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPP 504 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP-----PXXXGGPXFXP 80 PPPP PPPP GGPPP PP G P P Sbjct: 458 PPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPP 504 Score = 34.3 bits (75), Expect = 5.6 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP PPPP G PPP PP GG P PP G Sbjct: 483 PPPPP-----PPPPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPPPPPPPPG 530 Score = 33.9 bits (74), Expect = 7.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP GG PPP Sbjct: 459 PPPPPPPPPPPPPPPTQSSAAGGGPPPP 486 >UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 444 Score = 43.2 bits (97), Expect = 0.012 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = +3 Query: 48 PLXGGITFLXXGXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 PL GG G G P G GGG PP GGGGAP GGGG Sbjct: 100 PLGGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGG 152 Score = 41.1 bits (92), Expect = 0.049 Identities = 23/60 (38%), Positives = 25/60 (41%) Frame = +1 Query: 28 VQL*AXGPXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 ++L P G L G PP GGG GGPP PP GG P GGGG Sbjct: 85 IKLLGLPPGGGGAPGPLGGGGARPPGGGGG---GGPPSLPPGAGGGGGARPPAPGGGGGG 141 Score = 40.7 bits (91), Expect = 0.064 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G GPP G GGG PP P GGGG P GGGG Sbjct: 112 GGGGGPPSLPPGAGGGGGARPPAPGG-GGGGGAPRRVLGGGG 152 Score = 39.9 bits (89), Expect = 0.11 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G GP GGG GGG P P GGGG P GGGG Sbjct: 177 GGGGGPGRAPGGGGGGGGPGRAP--GGGGGGGGPGGGGGGGG 216 Score = 36.7 bits (81), Expect = 1.0 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = +3 Query: 27 GXAVSXRPLXGGITFLXXGXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G RP GG G G P GGG GGG P P GGGG P GGGG Sbjct: 153 GGGALARPPGGG-----RGGALGRPP--GGGGGGGGPGRAP--GGGGGGGGPGRAPGGGG 203 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G GP GG GGG P P GGGG P GGGG Sbjct: 177 GGGGGPGRAPGGGGGGGGPGRAP--GGGGGGGGPGGGGGGGG 216 Score = 35.5 bits (78), Expect = 2.4 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G PP GGG GGGP P GGGG P GGGG Sbjct: 167 GALGRPPGGGGG--GGGPGRAP---GGGGGGGGPGRAPGGGG 203 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G P GGG GGG PP G G P GGGG Sbjct: 139 GGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGG 180 >UniRef50_Q6ML35 Cluster: Putative uncharacterized protein; n=1; Bdellovibrio bacteriovorus|Rep: Putative uncharacterized protein - Bdellovibrio bacteriovorus Length = 265 Score = 42.7 bits (96), Expect = 0.016 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGG----PPPXXPPPXXGGPXF 87 PPPP PPPP GGG GG PPP PPP GG F Sbjct: 225 PPPPPPP---PPPPFGDDFGGGFGGDSDFPPPPPPPPFEGGGDF 265 Score = 39.9 bits (89), Expect = 0.11 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGG----PPPXPPPXXXGGPXF 86 PPPP PPPP GG GG PPP PPP GG F Sbjct: 225 PPPPPPP---PPPPFGDDFGGGFGGDSDFPPPPPPPPFEGGGDF 265 Score = 33.5 bits (73), Expect = 9.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP GG PPP Sbjct: 226 PPPPPPPPPPFGDDFGGGFGGDSDFPPP 253 >UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba histolytica|Rep: Diaphanous protein - Entamoeba histolytica Length = 1209 Score = 42.7 bits (96), Expect = 0.016 Identities = 22/53 (41%), Positives = 23/53 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP G PPPP G G PP PPP G P P + PP G Sbjct: 682 PPPPPGMPGMPPPPPGMPGMPGMPGMPP-PPPGMPGMPPPPPGMPGMPPPPPG 733 Score = 41.1 bits (92), Expect = 0.049 Identities = 28/96 (29%), Positives = 30/96 (31%), Gaps = 5/96 (5%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXG---- 149 G PPPP PPPP G PPPP G Sbjct: 605 GASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPP 664 Query: 148 -GGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 G G PP PPP G P P + PP G+ Sbjct: 665 PPGMPGMPP--PPPGMPGMPPPPPGMPGMPPPPPGM 698 Score = 38.7 bits (86), Expect = 0.26 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G G P PPP G P P P P Sbjct: 600 PPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPP 653 Score = 38.7 bits (86), Expect = 0.26 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 6/48 (12%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP------PXXPPPXXGGPXFXP 81 PPPP G PPPP G G G P P PPP G P P Sbjct: 682 PPPPPGMPGMPPPPPGMPGMPGMPGMPPPPPGMPGMPPPPPGMPGMPP 729 Score = 37.5 bits (83), Expect = 0.60 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG--GGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G G G PPP PP G P P P P Sbjct: 601 PPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPP 656 Score = 36.3 bits (80), Expect = 1.4 Identities = 23/59 (38%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP-----PPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP G PPPP G G PPP P PP G P P + PP G+ Sbjct: 662 PPPPPGMPGMPPPPP-----GMPGMPPPPPGMPGMPPPPPGMPGM-PGMPGMPPPPPGM 714 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP + PPP G PPP PPP G P Sbjct: 587 PPPPPPGASSIPPPPPPPGASSV--PPPPPPPGMPGMP 622 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP P G P P P P Sbjct: 588 PPPPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPP 641 >UniRef50_Q54ER5 Cluster: Formin homology domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: Formin homology domain-containing protein - Dictyostelium discoideum AX4 Length = 2546 Score = 42.7 bits (96), Expect = 0.016 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPP G PPPP GG GGPPP PPP G Sbjct: 1066 PPPGKSSGGGPPPPPPPPPKGGKGGPPP--PPPIGG 1099 Score = 41.5 bits (93), Expect = 0.037 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 PP G GGGPP PPPP G GG P GG Sbjct: 1064 PPPPPGKSSGGGPPPPPPPPPKGGKGGPPPPPPIGG 1099 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPP G PPPP G GGPPP PP Sbjct: 1066 PPPGKSSGGGPPPPPPPPPKGGKGGPPPPPP 1096 Score = 40.3 bits (90), Expect = 0.085 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G GGPPP PPP GG P Sbjct: 1061 PPPPPPPPGKSSGGGPPPPPPPPPKGGKGGPP 1092 Score = 39.9 bits (89), Expect = 0.11 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP GG PPP PP GGP P Sbjct: 1058 PPPPPP----PPPPPGKSSGGGPPPPPPPPPKGGKGGPPPPP 1095 Score = 39.1 bits (87), Expect = 0.20 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 PP G GGGPP PPP G GG P GG Sbjct: 1064 PPPPPGKSSGGGPPPPPPPPPKGGKGGPPPPPPIGG 1099 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP G GG PP PPPP GG P GG G Sbjct: 1065 PPPPGKSSGGGPPPPPPPPPKGGKGGPPPPPPIGGIG 1101 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP G GG P PPPP GG G P GG Sbjct: 1063 PPPPPPGKSSGGGPPPPPPPPPKGGKGGPPPPPPIGG 1099 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 42.7 bits (96), Expect = 0.016 Identities = 25/81 (30%), Positives = 25/81 (30%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP PPPP APPPP GG PPP Sbjct: 316 PPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARP--PPP 373 Query: 121 XPPPXXXGGPXFXPXXRXVIP 59 PPP P P IP Sbjct: 374 PPPPFGNAPPPPPPPPGSKIP 394 Score = 39.9 bits (89), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP APPPP G G PPP P G P Sbjct: 372 PPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGPP 409 Score = 39.5 bits (88), Expect = 0.15 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP GG PPP PPP P P P P Sbjct: 348 PPPPLPGQQAPPPPPPLPGGAR---PPPPPPPPFGNAPPPPPPPPGSKIPGPPP 398 Score = 38.3 bits (85), Expect = 0.34 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP GA PPP G PPP PP GP P Sbjct: 359 PPPPPLPGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPP 400 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPP G GPPP P GP P Sbjct: 371 PPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGPPPPP 412 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PPP G GPPP P GP P Sbjct: 371 PPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGPPPPP 412 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP------PPXXXGGP 92 PPPP PPPP G PPP P PP GGP Sbjct: 360 PPPPLPGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGP 403 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP PPP P P P P Sbjct: 360 PPPPLPGGARPPPPPPPPFGNA---PPPPPPPPGSKIPGPPPPPGGPRPPGPPP 410 Score = 35.1 bits (77), Expect = 3.2 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = -3 Query: 206 PPPPXXXXG--XPPPPXXXXGGGGXGGPPP-----XXPPPXXGGP 93 PPPP G PPPP G PPP PPP GGP Sbjct: 359 PPPPPLPGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGP 403 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G PPP P P P P PP Sbjct: 334 PPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPP 383 Score = 34.3 bits (75), Expect = 5.6 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP P P P P N+P P Sbjct: 334 PPPPIPGQQNPPPPPPPP-LPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPP 386 >UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; n=1; Candida albicans|Rep: Putative uncharacterized protein BNI1 - Candida albicans (Yeast) Length = 1732 Score = 42.7 bits (96), Expect = 0.016 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP PPPP GG P PPP P F VIPP+ Sbjct: 1051 PPPPPPPPPPPPPPLPPILGGNNSSAAPPPPPPPPPPPAFLNGSGSVIPPA 1101 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 PPPP PPPP GG P PPP P F Sbjct: 1051 PPPPPPPPPPPPPPLPPILGGNNSSAAPPPPPPPPPPPAF 1090 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP PPPP G G P P PPP G Sbjct: 1078 PPPPPPP---PPPPAFLNGSGSVIPPAPPLPPPSSG 1110 >UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: FH2 domain protein - Entamoeba histolytica HM-1:IMSS Length = 1212 Score = 42.3 bits (95), Expect = 0.021 Identities = 22/53 (41%), Positives = 23/53 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP G PPPP G G PPP P P G P P + PP G Sbjct: 650 PPPPPGMPGMPPPPPPP---GMPGMPPPPPLPGMPGMPPPPPGMPGMPPPPPG 699 Score = 40.3 bits (90), Expect = 0.085 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP G G PPP PPP G P P Sbjct: 638 PPPPPGASSVPPPPPPP---GMPGMPPPPPPPGMPGMPPPPP 676 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP G PPP PPP G P P Sbjct: 626 PPPPPGASSVPPPPPPP---GASSVPPPPPPPGMPGMPPPPP 664 Score = 37.1 bits (82), Expect = 0.79 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP----PXXPPPXXGGPXFXP 81 PPPP G PPPP G PP P PPP G P P Sbjct: 650 PPPPPGMPGMPPPPPPPGMPGMPPPPPLPGMPGMPPPPPGMPGMPP 695 Score = 36.7 bits (81), Expect = 1.0 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G G PPP PP G P P P P Sbjct: 638 PPPPPGASSVPPPPPPP---GMPGMPPPPPPPGMPGMPPPPPLPGMPGMPPPPP 688 Score = 36.7 bits (81), Expect = 1.0 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP--PPXXGGPXFXP 81 PPPP G PPPP G G PPP P PP G F P Sbjct: 662 PPPPPGMPGMPPPPPLP-GMPGMPPPPPGMPGMPPPPPGFGFRP 704 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP PP G P P P P Sbjct: 626 PPPPPGASSVPPPPPPP---GASSVPPPPPPPGMPGMPPPPPPPGMPGMPPPPP 676 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G PPP PP P P +PP Sbjct: 614 PPPPPGASSVPPPPPPP--GASSVPPPPPPPGASSVPPPPPPPGMPGMPP 661 Score = 33.9 bits (74), Expect = 7.4 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP + PPP G PPP PPP P P Sbjct: 613 PPPPPPGASSVPPPPPPPGASSV--PPPPPPPGASSVPPPPP 652 Score = 33.5 bits (73), Expect = 9.8 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG-GPXFXPXXRXVIPP 56 PPP APPPP G PPP PPP P P +PP Sbjct: 604 PPPSNTATAPPPPPP----GASSVPPPPPPPGASSVPPPPPPPGASSVPP 649 Score = 33.5 bits (73), Expect = 9.8 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 7/61 (11%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-------XXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP PPP G PPP PPP G P P P Sbjct: 613 PPPPPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPPPPPPGMPGMPPPPPPPGMPGMP 672 Query: 47 P 45 P Sbjct: 673 P 673 >UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; Danio rerio|Rep: Putative uncharacterized protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 428 Score = 42.3 bits (95), Expect = 0.021 Identities = 21/60 (35%), Positives = 23/60 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP G PPPP G PPP PPP G P PP + + P Sbjct: 352 PPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAP----PPPQNASMAPPP 407 Score = 41.1 bits (92), Expect = 0.049 Identities = 23/78 (29%), Positives = 23/78 (29%) Frame = -1 Query: 313 GGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXG 134 GG PPP PPPP PPPP G Sbjct: 289 GGSLVPPPPPPPGTNTTMTAPPPPPPPGNMSVPPPPPPPPGNMGVLPPPPPPRPGNMGVP 348 Query: 133 GPPPXPPPXXXGGPXFXP 80 PPP PPP G P P Sbjct: 349 PPPPPPPPGNMGVPPPPP 366 Score = 41.1 bits (92), Expect = 0.049 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = -1 Query: 310 GGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGG 131 G PPPP PPPP APPPP GG Sbjct: 360 GVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQNASMAPPPPPPPPLGGKFLP 419 Query: 130 PPPXPPP 110 PPP PPP Sbjct: 420 PPPPPPP 426 Score = 40.7 bits (91), Expect = 0.064 Identities = 23/66 (34%), Positives = 25/66 (37%), Gaps = 4/66 (6%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXN----SPXXGPXA 39 PPPP PPPP G G PPP PP G P P N P P Sbjct: 325 PPPPGNMGVLPPPPPPRPGNMGVPPPPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPG 384 Query: 38 YSXTXL 21 Y+ + L Sbjct: 385 YTGSSL 390 Score = 37.9 bits (84), Expect = 0.45 Identities = 24/87 (27%), Positives = 25/87 (28%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G G PPPP PPPP + PPP Sbjct: 343 GNMGVPPPPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQNAS 402 Query: 136 GGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPP PPP G F P PP Sbjct: 403 MAPPPPPPPPLGG--KFLPPPPPPPPP 427 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP G PPP PPP G P Sbjct: 352 PPPPPGNMGVPPPPPPPPPGNMCI-PPPPPPPPGYTGSSLPP 392 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXN 63 PPPP PPPP G G PPP P G P P N Sbjct: 311 PPPPPGNMSVPPPPPPPPGNMGVLPPPPPPRPGNMGVPPPPPPPPPGN 358 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP +PPPP GG PPP PPP Sbjct: 273 PPPPPPP--SPPPPGSVYGGSLV--PPPPPPP 300 >UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12; Magnoliophyta|Rep: H0211F06-OSIGBa0153M17.6 protein - Oryza sativa (Rice) Length = 1510 Score = 42.3 bits (95), Expect = 0.021 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 7/59 (11%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPP-------PXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPP G PPP G GG GGPP P PP GGP P +P G Sbjct: 1174 PPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPTPPMPPGVPGGPPPPPGGRGLPAPPGG 1232 Score = 42.3 bits (95), Expect = 0.021 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 7/59 (11%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXP-------PPXXXGGPXFXPXXRXVIPPSRG 47 PPP G PPP G G GGPP P PP GGP P R + P G Sbjct: 1174 PPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPTPPMPPGVPGGPPPPPGGRGLPAPPGG 1232 Score = 38.3 bits (85), Expect = 0.34 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PPPP G PPPP GG P P P G P P P P A Sbjct: 1112 PPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPA 1167 Score = 37.1 bits (82), Expect = 0.79 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PP P G PPPP GG G P P PP GG V PP Sbjct: 1139 PPLPEGIGGVPPPPPV---GGLGGPPAPPPPAGFRGGTPPPNAHGGVAPP 1185 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP G PPPP GG PP P P GG Sbjct: 1112 PPPPGGITGVPPPPPIGGLGGHQA-PPAPPLPEGIGG 1147 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP GG G PP PPP G Sbjct: 1099 PPPPSIGAGAPPPPPPP---GGITGVPP--PPPIGG 1129 >UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms|Rep: Ah1644 protein - Drosophila melanogaster (Fruit fly) Length = 1644 Score = 42.3 bits (95), Expect = 0.021 Identities = 22/60 (36%), Positives = 26/60 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP APPPP G PPP PPP GG P PP +++ + P Sbjct: 273 PPPPPMAPAAPPPPPPPINGA---APPPPPPPMINGGALPPP------PPPPSMQMASRP 323 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP PPPP G PPP PP GG Sbjct: 273 PPPPPMAPAAPPPPPPPINGAA---PPPPPPPMINGG 306 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP GG PPP PPP Sbjct: 285 PPPPPINGAAPPPPPPPMINGGALPPPP--PPP 315 >UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_53, whole genome shotgun sequence - Paramecium tetraurelia Length = 1117 Score = 42.3 bits (95), Expect = 0.021 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PP P G PPPP G G PPP PPP G P Sbjct: 597 PPLPGQKTGPPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIPP 638 Score = 41.9 bits (94), Expect = 0.028 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PP P G PPPP G G PPP PPP G P Sbjct: 597 PPLPGQKTGPPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIPP 638 Score = 39.1 bits (87), Expect = 0.20 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPP G G PPP P P GP P PP G K A P Sbjct: 569 PPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTGPPPPPP-----PPLPGQKAGAPP 623 Score = 37.9 bits (84), Expect = 0.45 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PP P G PPPP G GPPP PPP G P PP Sbjct: 584 PPLPGQKAGPPPPPPLP---GQKTGPPPPPPPPLPGQKAGAPPPPPPPPP 630 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PP P G PPPP G GPPP PPP G Sbjct: 584 PPLPGQKAGPPPPPPLP---GQKTGPPPPPPPPLPG 616 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP G G PPP P P GP P Sbjct: 561 PPPPP-----PPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPP 597 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 205 PPPPXXXXG---APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PPPP G G PP PPP G P Sbjct: 593 PPPPPPLPGQKTGPPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIP 637 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP 116 PP P GAPPPP G G PPP P Sbjct: 612 PPLPGQKAGAPPPPPPPPPPGQKGIPPPPP 641 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -3 Query: 206 PPPPXXXXGX---PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP G G PP PPP G P Sbjct: 593 PPPPPPLPGQKTGPPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIP 637 >UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14; Mammalia|Rep: Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 502 Score = 42.3 bits (95), Expect = 0.021 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPP G PPPP G GP P PPP G P P PPS G Sbjct: 359 PPPPGRGGPPPPPPPATG---RSGPLPPPPPGAGGPPMPPPPPPPPPPPSSG 407 Score = 39.5 bits (88), Expect = 0.15 Identities = 21/58 (36%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = -1 Query: 205 PPPPXXXXGA----PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP G PPPP G PPP PPP G P + P+ GL Sbjct: 368 PPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGL 425 Score = 37.5 bits (83), Expect = 0.60 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -3 Query: 206 PPPPXXXXGXP-PPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP P PPP GG PPP PPP G Sbjct: 370 PPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSG 407 Score = 37.1 bits (82), Expect = 0.79 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP G GP P PPP GGP P Sbjct: 359 PPPPGRGGPPPPPPP----ATGRSGPLP-PPPPGAGGPPMPP 395 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PP P PP P G G PPP PP GP P PP Sbjct: 343 PPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPP 392 Score = 35.1 bits (77), Expect = 3.2 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = -3 Query: 206 PPPPXXXXGX----PPPPXXXXGGGGXGGPPPXXPPPXXG-GPXFXP 81 PPPP G PPPP G PPP PPP G GP P Sbjct: 368 PPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPP 414 Score = 33.9 bits (74), Expect = 7.4 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG--GPXFXPXXXEXNSPXXGP 45 PPP G PPP G GGPPP PPP G GP P P P Sbjct: 351 PPPPTPRGPPPP--------GRGGPPPP-PPPATGRSGPLPPPPPGAGGPPMPPP 396 >UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|Rep: Formin-like protein 1 - Homo sapiens (Human) Length = 1100 Score = 42.3 bits (95), Expect = 0.021 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PP P PPPP G G PPP PPP GGP Sbjct: 578 PPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 615 Score = 39.5 bits (88), Expect = 0.15 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PP P PPPP G PPP PPP GGP Sbjct: 578 PPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 615 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAP-PPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PP G+P PPP G PPP PPP GP P PP Sbjct: 562 PPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPP 612 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PP P PPPP G GP P PPP P P GP Sbjct: 575 PPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPPDALGRRDSELGP 628 Score = 34.7 bits (76), Expect = 4.2 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = -3 Query: 206 PPPPXXXXGXP-PPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PP G P PPP G PPP PPP GP P P P A Sbjct: 562 PPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPPDA 618 >UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1331 Score = 41.9 bits (94), Expect = 0.028 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 9/69 (13%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGG---------XXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP GAPPPP G G PPP PPP GP P IPPS Sbjct: 825 PPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPA-PPPPPPPIPPS 883 Query: 52 RGLKLTAXP 26 A P Sbjct: 884 MAPGACAPP 892 Score = 38.7 bits (86), Expect = 0.26 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP-PXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G G PPP PP P P P +PP Sbjct: 813 PPPPLPCLSVPPPPPPLPG---MGAPPPPPPLPGLSAPPPPPPLPGMGVPP 860 Score = 37.5 bits (83), Expect = 0.60 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYSXT 27 PPPP PPPP G G PPP P P P P P P + T Sbjct: 813 PPPPLPCLSVPPPPPPLP---GMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHT 869 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPPP G PPP P P P Sbjct: 849 PPPPLPGMGVPPPPPPPLTHTGPAPPPPPPPIPPSMAP 886 Score = 34.7 bits (76), Expect = 4.2 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -3 Query: 206 PPPPXX-XXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G PPP P P G P P P P Sbjct: 824 PPPPPLPGMGAPPPPPPLP---GLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPPP 875 >UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n=2; Danio rerio|Rep: UPI00015A5D5E UniRef100 entry - Danio rerio Length = 1093 Score = 41.9 bits (94), Expect = 0.028 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 9/69 (13%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGG---------XXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP GAPPPP G G PPP PPP GP P IPPS Sbjct: 898 PPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPA-PPPPPPPIPPS 956 Query: 52 RGLKLTAXP 26 A P Sbjct: 957 MAPGACAPP 965 Score = 38.7 bits (86), Expect = 0.26 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP-PXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G G PPP PP P P P +PP Sbjct: 886 PPPPLPCLSVPPPPPPLPG---MGAPPPPPPLPGLSAPPPPPPLPGMGVPP 933 Score = 37.5 bits (83), Expect = 0.60 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYSXT 27 PPPP PPPP G G PPP P P P P P P + T Sbjct: 886 PPPPLPCLSVPPPPPPLP---GMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHT 942 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPPP G PPP P P P Sbjct: 922 PPPPLPGMGVPPPPPPPLTHTGPAPPPPPPPIPPSMAP 959 Score = 34.7 bits (76), Expect = 4.2 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -3 Query: 206 PPPPXX-XXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G PPP P P G P P P P Sbjct: 897 PPPPPLPGMGAPPPPPPLP---GLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPPP 948 >UniRef50_Q9VFZ6 Cluster: CG11670-PA; n=2; Sophophora|Rep: CG11670-PA - Drosophila melanogaster (Fruit fly) Length = 460 Score = 41.9 bits (94), Expect = 0.028 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP G PPP G G PPP PPP GGP Sbjct: 53 PPPPSPPCGRPPP-----GSPPPGPPPPGPPPGCPGGP 85 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPP G G PPP PP GGP Sbjct: 53 PPPPSPPCGRPPP-----GSPPPGPPPPGPPPGCPGGP 85 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 P P PPPP G G PPP PPP Sbjct: 44 PVPDPTRPPPPPPSPPCGRPPPGSPPPGPPP 74 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 P P PPPP G G PPP PPP Sbjct: 44 PVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPP 75 >UniRef50_O01864 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 988 Score = 41.9 bits (94), Expect = 0.028 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGG-PPPXXPPPXXGGPXFXP 81 PPP PPPP G GG GG PPP GGP F P Sbjct: 772 PPPRGGMHHMPPPPSFRGGRGGHGGPPPPHFDRRGGGGPPFRP 814 Score = 38.3 bits (85), Expect = 0.34 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXG-GGXXGGPPPXPPPXXXGGPXFXP 80 PPP PPPP G GG G PPP GGP F P Sbjct: 772 PPPRGGMHHMPPPPSFRGGRGGHGGPPPPHFDRRGGGGPPFRP 814 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GG G G P PPP GGGG P G G Sbjct: 784 PPSFRGGRGGHGGP-PPPHFDRRGGGGPPFRPENGRG 819 >UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Euteleostomi|Rep: Protein diaphanous homolog 1 - Homo sapiens (Human) Length = 1248 Score = 41.9 bits (94), Expect = 0.028 Identities = 24/60 (40%), Positives = 25/60 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPP G PPPP GG G PPP P P G P P PP G + A P Sbjct: 683 PPPLPGEAGMPPPPPPLPGG--PGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAP 740 Score = 41.5 bits (93), Expect = 0.037 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP G PPPP G G PPP PPP GGP P P P Sbjct: 670 PPPLPGSAGIPPPPPPLPGEAGM--PPP--PPPLPGGPGIPPPPPFPGGPGIPP 719 Score = 41.1 bits (92), Expect = 0.049 Identities = 22/57 (38%), Positives = 23/57 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAY 36 PPP G PPPP GG G PP PPP GGP P P P + Sbjct: 683 PPPLPGEAGMPPPPPPLPGGPGI--PP---PPPFPGGPGIPPPPPGMGMPPPPPFGF 734 Score = 35.5 bits (78), Expect = 2.4 Identities = 20/64 (31%), Positives = 24/64 (37%), Gaps = 4/64 (6%) Frame = -1 Query: 205 PPPPXXXXGA----PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKL 38 PPPP G+ PPPP G PPP P P P + PP G+ + Sbjct: 667 PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGM 726 Query: 37 TAXP 26 P Sbjct: 727 PPPP 730 >UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis thaliana|Rep: F23H11.22 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 929 Score = 41.5 bits (93), Expect = 0.037 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG-GPXFXPXXRXVIPP 56 PPPP APPPP G PPP PPP G GP P PP Sbjct: 385 PPPPPPSAAAPPPPPPPKKG--PAAPPPPPPPGKKGAGPPPPPPMSKKGPP 433 Score = 40.3 bits (90), Expect = 0.085 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP APPPP G G PP PPP GP P Sbjct: 398 PPPPKKGPAAPPPPPPP---GKKGAGPPPPPPMSKKGPPKPP 436 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG-GPXFXPXXXEXNSP 57 PPPP PPPP G PPP PP G GP P + P Sbjct: 385 PPPPPPSAAAPPPPPPPK--KGPAAPPPPPPPGKKGAGPPPPPPMSKKGPP 433 Score = 33.9 bits (74), Expect = 7.4 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXP--PPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP P PPP G G G PPP PP GP P Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPP--PPMSKKGPPKPP 436 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 41.5 bits (93), Expect = 0.037 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP +PPPP PPP PPP P P +PPS Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPPS 719 Score = 39.5 bits (88), Expect = 0.15 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP PPPP PPP PPP P P +PPS Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678 Score = 38.7 bits (86), Expect = 0.26 Identities = 21/60 (35%), Positives = 22/60 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPPP PPP PPP P P PPS + A P Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALP 717 Score = 36.3 bits (80), Expect = 1.4 Identities = 22/82 (26%), Positives = 22/82 (26%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP PPPP PPPP PPP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Query: 121 XPPPXXXGGPXFXPXXRXVIPP 56 PPP P P PP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPP 310 Score = 36.3 bits (80), Expect = 1.4 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPPP PPP PPP P P PP L + P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP PPP PPP P P SP Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP PPP PPP P P Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 33.9 bits (74), Expect = 7.4 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PPP PPP P P PP Sbjct: 214 PPPPPPLPPSPPPPSPPPP--PPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 33.9 bits (74), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PP P +PPPP PPP PPP P P PP Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 >UniRef50_A2F9Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 214 Score = 41.5 bits (93), Expect = 0.037 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPP APPPP G G G PP PPP P Sbjct: 106 PPPAADGAPAPPPPPPPPGAGADGQAPPPPPPPDGAAP 143 Score = 39.9 bits (89), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP PPPP G G G PP PPP P Sbjct: 106 PPPAADGAPAPPPPPPPPGAGADGQAPPPPPPPDGAAP 143 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP PPP G G G P PPP G Sbjct: 105 PPPPAADGAPAPPPPPPPPGAGADGQAPPPPPPPDG 140 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -1 Query: 202 PPPXXXXGAP-PPPXXXXGGGXXGGPPPXPPPXXXG 98 PPP GAP PPP G G P PPP G Sbjct: 105 PPPPAADGAPAPPPPPPPPGAGADGQAPPPPPPPDG 140 >UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 634 Score = 41.1 bits (92), Expect = 0.049 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP PPPP G G PPP PPP G P +SP G Sbjct: 548 PPPPPVPGNAPPPPPPPPPPPGAGAPPP-PPPPGPGLAPPPPKAGGSSSPPAG 599 Score = 40.7 bits (91), Expect = 0.064 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPP G PPP PPP P P + PP Sbjct: 537 PPPPSAPGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPPGPGLAPP 586 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 41.1 bits (92), Expect = 0.049 Identities = 28/91 (30%), Positives = 30/91 (32%), Gaps = 1/91 (1%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G GG PPPP PPPP PPPP G Sbjct: 1056 GAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPP-----PPPPMPGMAGMP- 1109 Query: 136 GGPPPXPPPXXXGGPXFXPXXRXVIP-PSRG 47 PPP PPP G P P +P P+ G Sbjct: 1110 --PPPPPPPPMPGMPGMPPPPPPPMPGPASG 1138 Score = 39.5 bits (88), Expect = 0.15 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGG-----GXGGPPPXXPPPXXGGP 93 PPPP PPPP G G GGPPP PPP P Sbjct: 1030 PPPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPP 1072 Score = 39.1 bits (87), Expect = 0.20 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP GA PP G G PPP PPP G P PP G+ Sbjct: 1071 PPPPGGLPGAAPP---MPGAGGPPPPPPPPPPPPMPGMAGMPPPPPPPPPMPGM 1121 Score = 38.7 bits (86), Expect = 0.26 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP GAP P G PPP PPP G P P Sbjct: 1041 PPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAP 1082 Score = 38.7 bits (86), Expect = 0.26 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP G P G GG PPP PPP G P P G Sbjct: 1068 PPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPPPMPGMAGMPPPPPPPPPMPG 1120 Score = 38.3 bits (85), Expect = 0.34 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG-PXFXPXXXEXNSPXXGP 45 PPPP P P GG PPP PPP GG P P P P Sbjct: 1040 PPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPP 1094 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGG-----XXGGPPPXPPP 110 PPPP PPPP G GGPPP PPP Sbjct: 1030 PPPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPP 1066 Score = 36.7 bits (81), Expect = 1.0 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 6/60 (10%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXG------GGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G G G PPP PPP P P GP Sbjct: 1031 PPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGP 1090 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPP G PPPP G G PP PPP G Sbjct: 1099 PPPMPGMAGMPPPPPPPPPMPGMPGMPPPPPPPMPG 1134 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP G GG PPP Sbjct: 1037 PPPPPPPPGFLPGAPAPIPGAGGPPPPP 1064 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP G GG PPP Sbjct: 1067 PPPPPPPPGGLPGAAPPMPGAGGPPPPP 1094 Score = 33.5 bits (73), Expect = 9.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP G G PPP Sbjct: 1036 PPPPPPPPPGFLPGAPAPIPGAGGPPPP 1063 >UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 664 Score = 41.1 bits (92), Expect = 0.049 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 P P PPPP G GGPPP PPP P F Sbjct: 498 PGVPGGVPPPPPPPPPGPGPAAAGGPPPPPPPPPGAAPSF 537 Score = 40.7 bits (91), Expect = 0.064 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXF 86 P P PPPP G GGPPP PPP P F Sbjct: 498 PGVPGGVPPPPPPPPPGPGPAAAGGPPPPPPPPPGAAPSF 537 Score = 39.9 bits (89), Expect = 0.11 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Frame = -1 Query: 205 PPP--PXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSR 50 PPP P APPP GG G PP PPP G P R PPSR Sbjct: 401 PPPELPGRAVPAPPPSLPARGGTPAAGGPPPPPPPRDGA---TPLSRPPPPPSR 451 Score = 37.9 bits (84), Expect = 0.45 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Frame = -1 Query: 205 PPP---PXXXXGAPPPPXXXXGGGXXGG-----PPPXPPPXXXGGPXFXP 80 PPP P G PPPP G G PPP PPP GGP P Sbjct: 511 PPPGPGPAAAGGPPPPPPPPPGAAPSFGSAAPPPPPGPPPAMSGGPPPPP 560 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = -1 Query: 205 PPP---PXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPP P APPPP G PPP PPP G Sbjct: 529 PPPGAAPSFGSAAPPPPPGPPPAMSGGPPPPPPPPGDFG 567 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXP 116 PPP G PPPP G GPPP P Sbjct: 548 PPPAMSGGPPPPPPPPGDFGVTPGPPPPP 576 Score = 34.7 bits (76), Expect = 4.2 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 7/65 (10%) Frame = -3 Query: 206 PPP--PXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG-----PXFXPXXXEXNSPXXG 48 PPP P PPP GG G PP PPP G P P P Sbjct: 401 PPPELPGRAVPAPPPSLPARGGTPAAGGPPPPPPPRDGATPLSRPPPPPSRSAIPPPAAA 460 Query: 47 PXAYS 33 P AY+ Sbjct: 461 PTAYT 465 Score = 33.5 bits (73), Expect = 9.8 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG-GPXFXPXXRXVIPPSRG 47 PPPP PPP G GG PP PPP G GP PP G Sbjct: 484 PPPPP-----PPPASSRPVPGVPGGVPPPPPPPPPGPGPAAAGGPPPPPPPPPG 532 Score = 33.5 bits (73), Expect = 9.8 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 9/51 (17%) Frame = -3 Query: 206 PPPPXXXX---GXPPPPXXXXGG-----GGXGGPPPXXPPP-XXGGPXFXP 81 PPPP G PPPP G G PPP PPP GGP P Sbjct: 510 PPPPGPGPAAAGGPPPPPPPPPGAAPSFGSAAPPPPPGPPPAMSGGPPPPP 560 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPP G PPPP G GPPP PP G Sbjct: 548 PPPAMSGGPPPPPPPPGDFGVTPGPPP--PPTGDAG 581 >UniRef50_UPI0000D8C71D Cluster: Wiskott-Aldrich syndrome protein (WASp).; n=3; Danio rerio|Rep: Wiskott-Aldrich syndrome protein (WASp). - Danio rerio Length = 490 Score = 40.7 bits (91), Expect = 0.064 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PPP GG G PPP PPP P P Sbjct: 355 PPPPTNRSGGLPPPLPEPSGG--GPPPPPPPPAAPPPPPAAP 394 Score = 39.5 bits (88), Expect = 0.15 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGG--XGGPPPXXPPPXXGGP 93 PPPP G PPP GGG PPP PPP P Sbjct: 355 PPPPTNRSGGLPPPLPEPSGGGPPPPPPPPAAPPPPPAAP 394 Score = 33.9 bits (74), Expect = 7.4 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 8/46 (17%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGG--------GXGGPPPXXPPPXXGGP 93 P PP G PPP GG GGPPP PPP P Sbjct: 344 PQPPGPRSGPLPPPPTNRSGGLPPPLPEPSGGGPPPPPPPPAAPPP 389 >UniRef50_Q23248 Cluster: Putative uncharacterized protein grl-21; n=2; Caenorhabditis|Rep: Putative uncharacterized protein grl-21 - Caenorhabditis elegans Length = 172 Score = 40.7 bits (91), Expect = 0.064 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXF 86 P P PPPP GGG PPP PPP GGP + Sbjct: 30 PQRPQQCCCPPPPPPPPCGGGYEA-PPPPPPPSYAGGPSY 68 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 P P PPPP GGG PPP PP GGP + Sbjct: 30 PQRPQQCCCPPPPPPPPC-GGGYEAPPPPPPPSYAGGPSY 68 >UniRef50_Q0KI93 Cluster: CG12946-PB, isoform B; n=4; Sophophora|Rep: CG12946-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 630 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP G PP P G G PPP PPP Sbjct: 500 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 531 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PP P G G PPP PPP G Sbjct: 500 PPPPAPPAGVPPAPPPMPVFGAGGAPPP-PPPPSSG 534 Score = 33.5 bits (73), Expect = 9.8 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPP G PPPP G PPP P G P P PPS G+ Sbjct: 489 PPPTAASVGVPPPPPAPPAG-VPPAPPPMPVFGAGGAPPPPP------PPSSGM 535 >UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1128 Score = 40.7 bits (91), Expect = 0.064 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG-PXFXPXXRXVIPP 56 PPPP PPPP G PPP PPP G P ++PP Sbjct: 598 PPPPVGAPPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPP 648 Score = 39.9 bits (89), Expect = 0.11 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP PPPP G PPP PPP G Sbjct: 598 PPPPVGAPPPPPPPPPPPPGVAAAAPPPPPPPPGLAG 634 Score = 37.9 bits (84), Expect = 0.45 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP------XXPPPXXGGPXFXP 81 PPPP PPPP G G PPP PPP G P P Sbjct: 613 PPPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPPPPPPPGAPGMPP 660 Score = 35.9 bits (79), Expect = 1.8 Identities = 20/55 (36%), Positives = 22/55 (40%), Gaps = 6/55 (10%) Frame = -1 Query: 202 PPPXXXXGAPP--PPXXXXGGGXXGGPPPXPPPXXXGG----PXFXPXXRXVIPP 56 PPP GAPP PP G PPP PPP P P ++PP Sbjct: 584 PPPTDLAGAPPVAPPPPPVGAPPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPP 638 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP G PP PPP Sbjct: 597 PPPPPVGAPPPPPPPPPPPPGVAAAAPPPPPP 628 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP G PP PPP Sbjct: 597 PPPPPVGAPPPPPPPPPPPPGVAAAAPPPPPPP 629 Score = 33.5 bits (73), Expect = 9.8 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 10/70 (14%) Frame = -1 Query: 205 PPPPXXXXGA---PPPPXXXXGG-------GXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP A PPPP G G PPP PPP G P P P Sbjct: 612 PPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPPPPPPPGAPGMPPPPPGMPRAPAP 671 Query: 55 SRGLKLTAXP 26 +R K P Sbjct: 672 ARPKKKNEAP 681 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 40.7 bits (91), Expect = 0.064 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP APPPP G PPP PPP P P PP Sbjct: 575 PPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPPPPMPGRAPPPPP 624 Score = 39.5 bits (88), Expect = 0.15 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP PPPP GG PPP PPP G P P P G Sbjct: 575 PPPPGGSLTAPPPPPPPPPPGGRLPPPP--PPPPGGMPPPPPMPGRAPPPPPG 625 Score = 38.7 bits (86), Expect = 0.26 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP---PXPPPXXXGGPXFXPXXRXVIPPSRG 47 P PP PPPP GG PP P PPP GG P PP G Sbjct: 541 PNPPQIAPPPPPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGG 596 Score = 38.3 bits (85), Expect = 0.34 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -3 Query: 206 PPPPXX----XXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP PPPP GG PPP PPP GG Sbjct: 556 PPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGG 596 Score = 36.7 bits (81), Expect = 1.0 Identities = 23/66 (34%), Positives = 25/66 (37%), Gaps = 6/66 (9%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGG------PPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP APPPP GG PPP PPP P P +PP + Sbjct: 556 PPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPPPPM 615 Query: 43 KLTAXP 26 A P Sbjct: 616 PGRAPP 621 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 P PP PPPP GG PPP PPP P Sbjct: 541 PNPPQIAPPPPPPPPPPPPGGLLTAPPPPPPPPPPPPP 578 >UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein), putative; n=1; Filobasidiella neoformans|Rep: Cytokinesis protein sepa (Fh1/2 protein), putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 1776 Score = 40.7 bits (91), Expect = 0.064 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP G G PPP PPP P Sbjct: 1090 PPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPPPPP 1127 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGG--GXXGGPPPXPPP 110 PPPP PPPP G G PPP PPP Sbjct: 1089 PPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPP 1122 >UniRef50_A4R9P2 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 216 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP APPPP GG PPP PP Sbjct: 88 PPPPAKDGAAPPPPPAKDGGDAAPPPPPPPP 118 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP GA PPP GG PPP PPP Sbjct: 88 PPPPAKDGAAPPPPPAKDGGDAAPPPPPPPP 118 >UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Protein enabled - Drosophila melanogaster (Fruit fly) Length = 829 Score = 40.7 bits (91), Expect = 0.064 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PP P APPPP GG GGPPP PP G P PP+ Sbjct: 549 PPAP-----APPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPA 594 Score = 40.3 bits (90), Expect = 0.085 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 8/45 (17%) Frame = -3 Query: 206 PPPPXXXXGXPP----PPXXXXG----GGGXGGPPPXXPPPXXGG 96 PPPP G PP PP G GG G PPP PPP GG Sbjct: 582 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGG 626 Score = 39.9 bits (89), Expect = 0.11 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 9/83 (10%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPP----PXXXXG 149 GG G PP P PPP G PPP P G Sbjct: 544 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 603 Query: 148 G-----GXXGGPPPXPPPXXXGG 95 G G G PPP PPP GG Sbjct: 604 GPPPAPGGPGAPPPPPPPPGLGG 626 Score = 37.5 bits (83), Expect = 0.60 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PP P G PPP GG PPP PPP G P Sbjct: 595 PPAPPAMGGGPPPAP----GGPGAPPPPPPPPGLGGAP 628 Score = 36.7 bits (81), Expect = 1.0 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 P PP GAPPPP GG PP PP GGP P PP Sbjct: 572 PAPPQMFNGAPPPPAM---GGGPPPAPPAPP-AMGGGPPPAPGGPGAPPP 617 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 PP GG GGGPP P PP G P GGG Sbjct: 557 PPPSFGGAAGGGPPPPAPPQMF--NGAPPPPAMGGG 590 Score = 36.3 bits (80), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 P PP G PPPP GG P P PP GGP P P P Sbjct: 572 PAPPQMFNGAPPPPAM----GGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 621 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 PP GG GGGPP PP G P GGG Sbjct: 557 PPPSFGGAAGGGPPPPAPPQMF--NGAPPPPAMGGG 590 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 97 PPXXGGGXXG--GGPPXPPPPXXXXGGGGXP 183 PP GGG GGP PPPP G GG P Sbjct: 598 PPAMGGGPPPAPGGPGAPPPPPPPPGLGGAP 628 >UniRef50_UPI0000ECC7D2 Cluster: melanoma inhibitory activity family, member 3; n=3; Gallus gallus|Rep: melanoma inhibitory activity family, member 3 - Gallus gallus Length = 1911 Score = 40.3 bits (90), Expect = 0.085 Identities = 22/56 (39%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIP-PSRGLK 41 PPPP G PP P G GP P P P G P P R +P PS G++ Sbjct: 1773 PPPPPVNYGPPPAPFP---GHYGPGPRPLPVPLVCGAPLPPPAARDFLPGPSLGIR 1825 >UniRef50_Q640S7 Cluster: Fmnl1 protein; n=3; Xenopus|Rep: Fmnl1 protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 1167 Score = 40.3 bits (90), Expect = 0.085 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PP P GAPPPP G G PPP PPP GP P Sbjct: 644 PPLPMGEQGAPPPPPSM---GAPGVPPPPPPPPSGFGPAPPP 682 Score = 38.7 bits (86), Expect = 0.26 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PP P G PPPP G G PPP PPP GP P Sbjct: 644 PPLPMGEQGAPPPPPSM---GAPGVPPPPPPPPSGFGPAPPP 682 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPP G PPPP G G PPP P Sbjct: 656 PPPSMGAPGVPPPPPPPPSGFGPAPPPPPGGQP 688 >UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Rep: Zgc:162320 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 412 Score = 40.3 bits (90), Expect = 0.085 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPP G PPPP G PPP PPP G P P PPS G Sbjct: 173 PPPAPASGPPPPPGPPPAPGPP-PPPPPPPPSGGGAPPAPP------PPSGG 217 Score = 40.3 bits (90), Expect = 0.085 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPPXXXXGGGG--XPXXXXGGGG 207 GPP G GPP PPPP GGG P GGGG Sbjct: 180 GPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSGGGG 219 Score = 39.9 bits (89), Expect = 0.11 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PP P G PPPP G GG PP PPP GG Sbjct: 184 PPGPPPAPGPPPPPPPPPPSG--GGAPPAPPPPSGGG 218 Score = 39.9 bits (89), Expect = 0.11 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PP P G PPPP G GG PP PPP GG Sbjct: 184 PPGPPPAPGPPPPPPPPPPSG--GGAPPAPPPPSGGG 218 Score = 39.1 bits (87), Expect = 0.20 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +3 Query: 93 GPPXXXGGGXGGGPPXXPPPXXXXGGGG--APXXXXGGGG 206 GPP G GPP PPP GGG AP GGGG Sbjct: 180 GPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSGGGG 219 Score = 39.1 bits (87), Expect = 0.20 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GG PP PPPP GGGG G GG Sbjct: 196 PPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGG 232 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPP G PPPP G PPP PPP GG Sbjct: 173 PPPAPASGPPPPPGPPPAPGPP--PPPPPPPPSGGG 206 Score = 37.5 bits (83), Expect = 0.60 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 P PP PPPP GG G PP PPP GG Sbjct: 185 PGPPPAPGPPPPPPPPPPSGG--GAPPAPPPPSGGGG 219 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 PP GG PP PPP GGGG G GG Sbjct: 196 PPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGG 232 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGG 132 PPPP G PP P GGGG GG Sbjct: 198 PPPPPSGGGAPPAPPPPSGGGGGGG 222 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 PP GGG P PPP GGGG GG G Sbjct: 195 PPPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDG 231 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGG 131 PPPP GAPP P GGG GG Sbjct: 198 PPPPPSGGGAPPAPPPPSGGGGGGG 222 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GGG P PPP GGGG GG G Sbjct: 195 PPPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDG 231 Score = 34.3 bits (75), Expect = 5.6 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -1 Query: 178 APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXPSXS 17 APPPP GPPP P P GP P PPS G A P S Sbjct: 165 APPPPPSAPPPAPASGPPPPPGPPPAPGP---PPPPPPPPPSGGGAPPAPPPPS 215 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = -3 Query: 206 PPPPXX----XXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP G PPP PP G P P Sbjct: 167 PPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPP 212 >UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; Anaeromyxobacter dehalogenans 2CP-C|Rep: Putative uncharacterized protein - Anaeromyxobacter dehalogenans (strain 2CP-C) Length = 359 Score = 40.3 bits (90), Expect = 0.085 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP GG G PP PPP G P Sbjct: 78 PPPPPPGGELPPPPPPPPGGYG-APPPAWGPPPPSGAP 114 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPX-PPPXXXGGP 92 PPPP PPPP GG G PPP PP G P Sbjct: 78 PPPPPPGGELPPPPPPPPGG--YGAPPPAWGPPPPSGAP 114 Score = 34.3 bits (75), Expect = 5.6 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Frame = -3 Query: 206 PPPPXXXXGXPPP------PXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPP P GG G PP PPP GP Sbjct: 91 PPPPPGGYGAPPPAWGPPPPSGAPGGWG----PPPPPPPMPSGP 130 Score = 33.5 bits (73), Expect = 9.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPP 153 GPP G G GPP PPPP Sbjct: 106 GPPPPSGAPGGWGPPPPPPP 125 >UniRef50_Q9W384 Cluster: CG7055-PA; n=4; Endopterygota|Rep: CG7055-PA - Drosophila melanogaster (Fruit fly) Length = 749 Score = 40.3 bits (90), Expect = 0.085 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 199 PPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PP G PPPP G GGPP PPP GGP Sbjct: 558 PPPGMPGLPPPPPHT-GYANYGGPPHGPPPGPPGGP 592 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 200 PPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PP G PPPP G GGPP PP GGP Sbjct: 558 PPPGMPGLPPPPPHT-GYANYGGPPHGPPPGPPGGP 592 >UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 866 Score = 40.3 bits (90), Expect = 0.085 Identities = 20/55 (36%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXG----GGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP G PPPP G G PPP PPP G P + + P+ Sbjct: 85 PPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPPPPPSGLGVAPQPPRPKTPVNPA 139 Score = 34.7 bits (76), Expect = 4.2 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGG-----GXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKL 38 PPP G PPPP GG GG PP PP P P V P K Sbjct: 75 PPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPPPPPSGLGVAPQPPRPKT 134 Query: 37 TAXPS 23 P+ Sbjct: 135 PVNPA 139 Score = 34.7 bits (76), Expect = 4.2 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGG-----GGXGGPPPXXPPPXXGGPXFXP 81 PPP G PPPP GG GG PP PPP G P P Sbjct: 75 PPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPP--PPPMFGAPPPPP 118 >UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1373 Score = 40.3 bits (90), Expect = 0.085 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXP--PPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G P PPP G G PPP PP G P P Sbjct: 1293 PPPPMPSAGAPGGPPPPPPPPPPGMGAPPPPPMPPMGGAPAAPP 1336 Score = 39.5 bits (88), Expect = 0.15 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -1 Query: 205 PPPPXXXXGAP--PPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP GAP PPP G PPP P P G P P Sbjct: 1293 PPPPMPSAGAPGGPPPPPPPPPPGMGAPPPPPMPPMGGAPAAPP 1336 Score = 38.7 bits (86), Expect = 0.26 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G G PPP PPP G P P +P P Sbjct: 1293 PPPPMPSAGAPGGPPPPPPPPPPGMGAPPPPPMPPMGGAPAAPP 1336 Score = 38.3 bits (85), Expect = 0.34 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 Query: 178 APPPPXXXXGGGXXGGPPPXPPPXXXG 98 +PPPP G GGPPP PPP G Sbjct: 1290 SPPPPPPMPSAGAPGGPPPPPPPPPPG 1316 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP GAPPPP GG PP P Sbjct: 1310 PPPPPPGMGAPPPPPMPPMGGAPAAPPAGGRP 1341 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPPP G PPPP GG PP P Sbjct: 1310 PPPPPPGMGAPPPPPMPPMGGAPAAPPAGGRP 1341 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 PP G GG PP PPPP G P GG Sbjct: 1295 PPMPSAGAPGGPPPPPPPPPPGMGAPPPPPMPPMGG 1330 >UniRef50_Q6P0D5 Cluster: WW domain-binding protein 11; n=7; Euteleostomi|Rep: WW domain-binding protein 11 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 640 Score = 40.3 bits (90), Expect = 0.085 Identities = 24/62 (38%), Positives = 25/62 (40%), Gaps = 2/62 (3%) Frame = -1 Query: 202 PPPXXXXGAPP--PPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAX 29 PPP G PP PP G PPP PPP G P P PP L+A Sbjct: 440 PPPGLPPGPPPRGPPPRLPPPAPPGMPPP-PPPPRAGPPRMAPPLSLFPPPLNPNVLSAP 498 Query: 28 PS 23 PS Sbjct: 499 PS 500 Score = 38.7 bits (86), Expect = 0.26 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -3 Query: 203 PPPXXXXGXPP-PPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP G PP PP G GPPP PPP G P P P Sbjct: 428 PPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGMPPPPPPPRAGPPRMAP 481 Score = 35.9 bits (79), Expect = 1.8 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = -1 Query: 202 PPPXXXXGAPP-PPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPP G PP PP G GPPP PP G P PP L+ P Sbjct: 428 PPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGMPPPPPPPRAGPPRMAPPLSLFP 487 Score = 33.9 bits (74), Expect = 7.4 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 200 PPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PP G PP P G GPPP PPP P P GP Sbjct: 425 PPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGMPPPPPPPRAGP 476 >UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein; n=39; Eukaryota|Rep: Neural Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 505 Score = 40.3 bits (90), Expect = 0.085 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = -1 Query: 205 PPPPXXXX----GAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP G PPPP G G PPP PPP G P Sbjct: 345 PPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPP 386 Score = 38.3 bits (85), Expect = 0.34 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPP--PXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP P PPPP G G PPP PPP GP P Sbjct: 346 PPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 37.5 bits (83), Expect = 0.60 Identities = 21/58 (36%), Positives = 22/58 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTA 32 PPPP GAPPPP PPP PP P R PP L +A Sbjct: 300 PPPPARGRGAPPPP---PSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSA 354 Score = 37.5 bits (83), Expect = 0.60 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP GPPP PP GP P PP Sbjct: 335 PPPPPNRMYPPPPPALPSSA--PSGPPPPPPSVLGVGPVAPPPPPPPPPP 382 Score = 36.7 bits (81), Expect = 1.0 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = -1 Query: 178 APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP-XXRXVIPPSRGLKLTAXP 26 APPPP GG PPP PPP GP P R PP TA P Sbjct: 276 APPPPPPSRGG-----PPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAP 322 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP----XXPPPXXGGPXFXPXXXEXNSP 57 PPPP G PPPP G PP PPP P P + P Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRP 330 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP GPPP P GP P P P Sbjct: 335 PPPPPNRMYPPPPPALP--SSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPP 386 Score = 33.5 bits (73), Expect = 9.8 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = -3 Query: 206 PPPPXXXX----GXPPPPXXXXGGGGXGGPPPXX--PPPXXGGPXFXPXXXEXNSP 57 PPPP G PPPP G G PPP PPP P P + P Sbjct: 345 PPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVP 400 >UniRef50_Q92945 Cluster: Far upstream element-binding protein 2; n=98; Euteleostomi|Rep: Far upstream element-binding protein 2 - Homo sapiens (Human) Length = 710 Score = 40.3 bits (90), Expect = 0.085 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = +3 Query: 81 GXKXGPPXXXG-----GGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 G GPP G GG GGGPP PP GGGG GGG Sbjct: 8 GPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPCGGGPGGG 53 Score = 38.7 bits (86), Expect = 0.26 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 97 PPXXGGGXXGG--GPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GGG GG G P P PP GGG P GGG Sbjct: 15 PPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPCGGGPGGG 53 Score = 37.1 bits (82), Expect = 0.79 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +1 Query: 97 PPXXGG----GXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 PP GG G GGGPP PP GGGG GGG Sbjct: 14 PPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPCGGGPGGG 53 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPP G PPP G GG GG PP PP Sbjct: 9 PPP----GPPPPAGGGGGAGGAGGGPPPGPP 35 >UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 protein; n=2; Danio rerio|Rep: PREDICTED: similar to LOC495114 protein - Danio rerio Length = 904 Score = 39.9 bits (89), Expect = 0.11 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 10/71 (14%) Frame = -1 Query: 205 PPPPXXXXG-APPPPXXXXGGGXXG--GPPPXPPPXXXG-------GPXFXPXXRXVIPP 56 PPPP G APPPP G G PPP PPP G P P IPP Sbjct: 306 PPPPVPGLGSAPPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGGLSIPP 365 Query: 55 SRGLKLTAXPS 23 GL T PS Sbjct: 366 PPGL-FTTSPS 375 Score = 39.5 bits (88), Expect = 0.15 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -3 Query: 206 PPPPXXXXGX---PPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP G G PPP PPP G Sbjct: 306 PPPPVPGLGSAPPPPPPPPPPGPAGLFSPPPPPPPPPPG 344 Score = 38.3 bits (85), Expect = 0.34 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = -3 Query: 206 PPPPXXXXGX----PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP G G PPP PPP GG P Sbjct: 322 PPPPPGPAGLFSPPPPPPPPPPGFAGLASPPP--PPPPPGGLSIPP 365 Score = 37.9 bits (84), Expect = 0.45 Identities = 22/57 (38%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Frame = -1 Query: 205 PPPPXXXXG--APPPPXXXXGGGXXG-GPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP G +PPPP G G PP PPP G P PS+GL Sbjct: 322 PPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGGLSIPPPPGLFTTSPSQGL 378 Score = 34.7 bits (76), Expect = 4.2 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP G G PPP PPP G F P PP L + P Sbjct: 304 PPPPPPVPGLGSAPPPPPPPPPPGPAG-LFSPPPPPPPPPPGFAGLASPP 352 >UniRef50_UPI0000E49E39 Cluster: PREDICTED: similar to Wiskott-Aldrich syndrome (eczema-thrombocytopenia); n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to Wiskott-Aldrich syndrome (eczema-thrombocytopenia) - Strongylocentrotus purpuratus Length = 492 Score = 39.9 bits (89), Expect = 0.11 Identities = 23/61 (37%), Positives = 24/61 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP APPPP G PP PPP G P +PPSR P Sbjct: 271 PPPPSRGSHAPPPPPSRTPGPPLPNRPPAPPP--PGNSRGPPP--PAVPPSRSYPSAPAP 326 Query: 25 S 23 S Sbjct: 327 S 327 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP G PP PPP Sbjct: 271 PPPPSRGSHAPPPPPSRTPGPPLPNRPPAPPPP 303 >UniRef50_UPI0000E4922C Cluster: PREDICTED: similar to Enabled homolog (Drosophila); n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to Enabled homolog (Drosophila) - Strongylocentrotus purpuratus Length = 439 Score = 39.9 bits (89), Expect = 0.11 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PP P P PP GGG PPP PPP GGP Sbjct: 228 PPAPAAPPAPPAPPAPPAGGG----PPPPPPPPAIGGP 261 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GGGPP PPPP G GGGG Sbjct: 237 PPAPPAPPAGGGPPPPPPPPAIGGPSASSGGGGGGGG 273 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PP P P PP GGG PPP PPP GGP Sbjct: 228 PPAPAAPPAPPAPPAPPAGGGP---PPP-PPPPAIGGP 261 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 PP GGGPP PPP G + GGGG Sbjct: 237 PPAPPAPPAGGGPPPPPPPPAIGGPSASSGGGGGGGG 273 >UniRef50_Q61QV1 Cluster: Putative uncharacterized protein CBG06865; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG06865 - Caenorhabditis briggsae Length = 646 Score = 39.9 bits (89), Expect = 0.11 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 9/46 (19%) Frame = +1 Query: 97 PPXXGGGXXGGG---------PPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GGG GGG P PPPP GGGG GGGG Sbjct: 52 PPPCGGGCGGGGVCGGGGVCAPALPPPPPCGGGGGGCGGGCGGGGG 97 Score = 36.3 bits (80), Expect = 1.4 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 10/47 (21%) Frame = +3 Query: 96 PPXXXGGGXGGG----------PPXXPPPXXXXGGGGAPXXXXGGGG 206 PP GGG GGG P PPP GGGG GGGG Sbjct: 51 PPPPCGGGCGGGGVCGGGGVCAPALPPPPPCGGGGGGCGGGCGGGGG 97 Score = 35.1 bits (77), Expect = 3.2 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG PPPP G GG GGGG Sbjct: 30 GGGCGGGCGGGGGCGGGCGPPPPPPCGGGCGG--GGVCGGGG 69 >UniRef50_A7SHT8 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1505 Score = 39.9 bits (89), Expect = 0.11 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP PPPP GGG G P P PP Sbjct: 954 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 984 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP GGG G PP PPP Sbjct: 954 PPPPPGGGMFPPPPPPPPGGGVPG--PPKPPPP 984 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PP G PPPP GGG PPP PP GP P Sbjct: 945 PPNPFFGGIPPPPP---GGGMFPPPPPPPPGGGVPGPPKPP 982 Score = 33.9 bits (74), Expect = 7.4 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PP G PPPP GGG PPP PPP GG Sbjct: 945 PPNPFFGGIPPPPP----GGGMFPPPP--PPPPGGG 974 >UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_73, whole genome shotgun sequence - Paramecium tetraurelia Length = 442 Score = 39.9 bits (89), Expect = 0.11 Identities = 20/53 (37%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGP---PPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP GAPPPP G P PP PPP P + + PP Sbjct: 80 PPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLPPP 132 Score = 34.7 bits (76), Expect = 4.2 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGP---PPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G P PP PPP P P P Sbjct: 80 PPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLPPPPPPP 136 Score = 33.9 bits (74), Expect = 7.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 178 APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 APPPP G PP PPP G P P PP Sbjct: 73 APPPPPPPPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNPP 113 >UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 493 Score = 39.9 bits (89), Expect = 0.11 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLK 41 PP APPPP G PPP PPP P P + PP G + Sbjct: 354 PPQQQQNKSAPPPPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPPAGAR 408 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PP PPPP G PPP PPP P P + P G A Sbjct: 354 PPQQQQNKSAPPPPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPPAGARA 409 >UniRef50_A0CRC9 Cluster: Chromosome undetermined scaffold_25, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_25, whole genome shotgun sequence - Paramecium tetraurelia Length = 1300 Score = 39.9 bits (89), Expect = 0.11 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PP P APPPP GGPPP PPP G Sbjct: 778 PPEPPTVKVAPPPPPPPPPSLKPGGPPPPPPPPMKG 813 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PP P PPPP GGPPP PPP G Sbjct: 778 PPEPPTVKVAPPPPPPPPPSLKPGGPPPPPPPPMKG 813 >UniRef50_Q96WL0 Cluster: TPR-containing protein Mql1; n=4; Dikarya|Rep: TPR-containing protein Mql1 - Ustilago maydis (Smut fungus) Length = 1292 Score = 39.9 bits (89), Expect = 0.11 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP G PP G G GGPPP PPP Sbjct: 74 PPPSTHGGPPPRMVMADGPGGAGGPPPPPPP 104 Score = 39.5 bits (88), Expect = 0.15 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPP G PP G GG GGPPP PP Sbjct: 74 PPPSTHGGPPPRMVMADGPGGAGGPPPPPPP 104 >UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cerevisiae YJL020c; n=1; Candida glabrata|Rep: Similar to sp|P47068 Saccharomyces cerevisiae YJL020c - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 1039 Score = 39.9 bits (89), Expect = 0.11 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -1 Query: 199 PPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PP G PPPP G G PPP PPP P P PP Sbjct: 659 PPVPMSGIPPPPSDH--SGPHGAPPPPPPPTHTAHPPPPPPTHAAHPP 704 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 200 PPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PP G PPPP G G PPP PP P P + P P A Sbjct: 659 PPVPMSGIPPPPSDH--SGPHGAPPPPPPPTHTAHPPPPPPTHAAHPPPPPPTA 710 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP A PPP G PPP PP Sbjct: 692 PPPPPPTHAAHPPPPPPTAGHDGQAPPPLPP 722 >UniRef50_Q6C0S3 Cluster: Yarrowia lipolytica chromosome F of strain CLIB122 of Yarrowia lipolytica; n=1; Yarrowia lipolytica|Rep: Yarrowia lipolytica chromosome F of strain CLIB122 of Yarrowia lipolytica - Yarrowia lipolytica (Candida lipolytica) Length = 946 Score = 39.9 bits (89), Expect = 0.11 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPP G P PP G GG GGP P P GGP P P Sbjct: 833 PPPQGYQGAPQPPRHG-GPGGPGGPGAYGPGPGPGGPGGPPGGIHRPQP 880 >UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; Basidiomycota|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 464 Score = 39.9 bits (89), Expect = 0.11 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 205 PPPPXXXXG---APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G APPPP GG PP PPP P P Sbjct: 310 PPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPPPPPTSAPSAPP 354 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSR 50 PPPP A PP PPP PPP G P PP+R Sbjct: 282 PPPPPPGRPAAPPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPAR 333 Score = 33.9 bits (74), Expect = 7.4 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP--PXXGGPXFXP 81 PPPP PPPP G G PPP PP P G P P Sbjct: 304 PPPPPP----PPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPP 343 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP G PPP PPP P P Sbjct: 304 PPPP------PPPPPPVRSDGTGVAPPPPPPPPPARPPGGAP 339 >UniRef50_UPI00015B41F1 Cluster: PREDICTED: similar to ENSANGP00000005528; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ENSANGP00000005528 - Nasonia vitripennis Length = 1205 Score = 39.5 bits (88), Expect = 0.15 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 P PP APPPP GGPPP P P G P + P +GL Sbjct: 338 PKPPPPTRPAPPPPATVPVSAHGGGPPPRPSP-PVGAAGAPPPRPAPVHPHQGL 390 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 P PP PPPP GGPPP PP Sbjct: 338 PKPPPPTRPAPPPPATVPVSAHGGGPPPRPSPP 370 >UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein cappuccino; n=1; Tribolium castaneum|Rep: PREDICTED: similar to Protein cappuccino - Tribolium castaneum Length = 1011 Score = 39.5 bits (88), Expect = 0.15 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 5/78 (6%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGG--- 146 G G PPPP PPPP PPPP GG Sbjct: 479 GIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPPPMPGTGPPPPPPPMGGVPP 538 Query: 145 --GXXGGPPPXPPPXXXG 98 GGP P PPP G Sbjct: 539 PPPPMGGPVPLPPPPAGG 556 Score = 39.1 bits (87), Expect = 0.20 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP----XXPPPXXGGPXFXP 81 PPPP G PPPP G G PPP PPP GGP P Sbjct: 506 PPPPMPGIGGPPPP-PMPGTGPPPPPPPMGGVPPPPPPMGGPVPLP 550 Score = 37.5 bits (83), Expect = 0.60 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP GAPPPP G PPP P P P P V PP Sbjct: 462 PPPPMPGIGAPPPPPMP----GIGAPPPPPMPGIGAHPP-PPMPGIVGPP 506 Score = 37.1 bits (82), Expect = 0.79 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIP 59 PPPP G PPPP G PP PPP G P P +P Sbjct: 506 PPPPMPGIGGPPPPPMPGTG------PPPPPPPMGGVPPPPPPMGGPVP 548 Score = 36.7 bits (81), Expect = 1.0 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 7/61 (11%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGG-------GXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP G PPPP G G GPPP P P GGP P P Sbjct: 473 PPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPP-PPMPGIGGPPPPPMPGTGPPPPPP 531 Query: 47 P 45 P Sbjct: 532 P 532 Score = 36.3 bits (80), Expect = 1.4 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP GGPPP PP G P P V PP Sbjct: 495 PPPPMPGIVGPPPPPMPG----IGGPPP-PPMPGTGPPPPPPPMGGVPPP 539 Score = 36.3 bits (80), Expect = 1.4 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG------GGXGGPPPXXPPPXXGGPXFXP 81 PPP G PPPP GG G G PPP PPP G P P Sbjct: 496 PPPMPGIVGPPPPPMPGIGGPPPPPMPGTGPPPP--PPPMGGVPPPPP 541 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG-----GGXGGPPPXXPPPXXG 99 PPPP PPPP GG GGP P PPP G Sbjct: 516 PPPPPMPGTGPPPPPPPMGGVPPPPPPMGGPVPLPPPPAGG 556 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP G G PPP P P G Sbjct: 462 PPPPMPGIGAPPPPPMP----GIGAPPP-PPMPGIG 492 >UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV.; n=4; Xenopus tropicalis|Rep: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. - Xenopus tropicalis Length = 1182 Score = 39.5 bits (88), Expect = 0.15 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP G PPPP G G PPP P P Sbjct: 692 PPPPFPGGGPPPPPPPFPGYGSSAVPPPLPLP 723 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP + PPP G GGPPP PPP G P Sbjct: 680 PPPPLPDLSSVPPPPPFPG----GGPPPPPPPFPGYGSSAVP 717 Score = 37.9 bits (84), Expect = 0.45 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP G G PP P P G Sbjct: 691 PPPPPFPGGGPPPPPPPFPGYGSSAVPPPLPLPLPG 726 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPP GG G PPP P P G P Sbjct: 680 PPPPLPDLSSVPPPPPFPGG---GPPPPPPPFPGYGSSAVPP 718 >UniRef50_A6G120 Cluster: Putative periplasmic protein TonB; n=1; Plesiocystis pacifica SIR-1|Rep: Putative periplasmic protein TonB - Plesiocystis pacifica SIR-1 Length = 807 Score = 39.5 bits (88), Expect = 0.15 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG P P P GGGG GGGG Sbjct: 610 GAGAGGGTSGGGAGGGGVPAPGVPAPSLGGGGGGGRGGGGGG 651 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GG GGG P P GGGG GGGG Sbjct: 610 GAGAGGGTSGGGAGGGGVPAPGVPAPSLGGGGGGGRGGGGGG 651 >UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Length = 377 Score = 39.5 bits (88), Expect = 0.15 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPP G PPPP GG PP PPP P P PP Sbjct: 54 PPPPPPGGYPPPPQGGFPPPPPGGYPPPPPPQGGSYPPPPPPGAAGYPP 102 Score = 38.3 bits (85), Expect = 0.34 Identities = 24/64 (37%), Positives = 25/64 (39%), Gaps = 7/64 (10%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXG-----GGGXGGPPP--XXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP G PPPP G GG G PP PPP GG P + P Sbjct: 18 PPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGG---YPPPPQGGFPPPP 74 Query: 47 PXAY 36 P Y Sbjct: 75 PGGY 78 Score = 36.7 bits (81), Expect = 1.0 Identities = 20/50 (40%), Positives = 22/50 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G PP G GG PP PPP GG + P + PP Sbjct: 28 PPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPP---GG--YPPPPQGGFPP 72 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPP G PPPP GG PP PPP GG Sbjct: 54 PPPPPPGGYPPPPQGGFPPPPPGGYPP--PPPPQGG 87 >UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23; n=5; Bilateria|Rep: Putative uncharacterized protein grl-23 - Caenorhabditis elegans Length = 385 Score = 39.5 bits (88), Expect = 0.15 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG PPPP GG G GGGG Sbjct: 35 GCGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGG 76 Score = 36.7 bits (81), Expect = 1.0 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPP---XXXXGGGGXPXXXXGGGG 207 G G GGG GG P PPPP GGGG GGGG Sbjct: 93 GGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGCGGGG 137 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG PPP GG G GGGG Sbjct: 35 GCGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGG 76 >UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 1648 Score = 39.5 bits (88), Expect = 0.15 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP PPPP G G GPPP PPP G Sbjct: 984 PPPPPP----PPPPMPGQGPPGFNGPPPPPPPPPPPG 1016 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP PPPP G GPPP PPP G Sbjct: 984 PPPPPP----PPPPMPGQGPPGFNGPPPPPPPPPPPG 1016 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP PPP G GGPPP PPP G Sbjct: 1005 PPPPPPPP--PPPGMNAPVAPGFGGPPPPPPPPPPPG 1039 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP G GG PPP Sbjct: 1005 PPPPPPPPPPPGMNAPVAPGFGGPPPPP 1032 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP PPP GGPPP PPP G Sbjct: 1005 PPPPPPPP--PPPGMNAPVAPGFGGPPPPPPPPPPPG 1039 >UniRef50_O28253 Cluster: Putative uncharacterized protein; n=1; Archaeoglobus fulgidus|Rep: Putative uncharacterized protein - Archaeoglobus fulgidus Length = 544 Score = 39.5 bits (88), Expect = 0.15 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 691 GGGGGXGXGGXXPPPPXXPPXXXP 620 GGGGG G GG PPPP PP P Sbjct: 360 GGGGGGGGGGGGPPPPVLPPVQPP 383 Score = 33.5 bits (73), Expect = 9.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 173 PPPXXXXGGGGXGGPPPXXPPP 108 PP GGGG GGPPP PP Sbjct: 358 PPGGGGGGGGGGGGPPPPVLPP 379 >UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family member 4; n=37; Euteleostomi|Rep: Wiskott-Aldrich syndrome protein family member 4 - Homo sapiens (Human) Length = 625 Score = 39.5 bits (88), Expect = 0.15 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP G PPPP G G G PPP P P F PP+ P Sbjct: 451 PPPPPPMIGIPPPPPPI-GFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPP 509 Query: 25 SXS 17 S Sbjct: 510 PLS 512 Score = 38.3 bits (85), Expect = 0.34 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 PPPP G PPPP G G G PPP P P F Sbjct: 451 PPPPPPMIGIPPPPPPI-GFGSPGTPPPPSSPSFPPHPDF 489 Score = 35.1 bits (77), Expect = 3.2 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 2/93 (2%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXX--GAPPPPXXXXGGG 143 G G PPPP PPPP GAPPPP G Sbjct: 470 GSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPG- 528 Query: 142 XXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPP P G P P P L Sbjct: 529 ----PPPPPFTGADGQPAVPPPLSDTTKPKSSL 557 >UniRef50_A0JLT2 Cluster: Mediator of RNA polymerase II transcription subunit 19; n=31; Euteleostomi|Rep: Mediator of RNA polymerase II transcription subunit 19 - Homo sapiens (Human) Length = 244 Score = 39.5 bits (88), Expect = 0.15 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -3 Query: 173 PPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPP G G G PPP PPP GGP P +P Sbjct: 14 PPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAP 52 >UniRef50_UPI0000DC00CB Cluster: SH3 domain binding protein CR16; n=1; Rattus norvegicus|Rep: SH3 domain binding protein CR16 - Rattus norvegicus Length = 456 Score = 39.1 bits (87), Expect = 0.20 Identities = 19/53 (35%), Positives = 22/53 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 P PP APPPP PPP PPP P P +PP++G Sbjct: 185 PVPPRPSVPAPPPPTTPPPPPPPP-PPPPPPPLPPASPIKAPSVSPPVPPTKG 236 >UniRef50_Q20IN6 Cluster: HrpW; n=1; Pseudomonas cichorii|Rep: HrpW - Pseudomonas cichorii Length = 561 Score = 39.1 bits (87), Expect = 0.20 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = +3 Query: 57 GGITFLXXGXKXGPPXXXGGGXGGGPPXX------PPPXXXXGGGGAPXXXXGGGG 206 GG + G G P GGG GG P P GGGGAP GGGG Sbjct: 255 GGAPSIGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGG 310 Score = 38.7 bits (86), Expect = 0.26 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = +3 Query: 57 GGITFLXXGXKXGPPXXXGGGXGGGPPXX------PPPXXXXGGGGAPXXXXGGGG 206 GG + G G P GGG GG P P GGGGAP GGGG Sbjct: 266 GGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGG 321 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G P GGG GG P GGGGAP GGGG Sbjct: 252 GGGGGAPSIGGGGGGGAPSVG-----GGGGGGAPSVGGGGGG 288 Score = 34.7 bits (76), Expect = 4.2 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 46 GPXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G S G G P GGG GG P GGGG P GGGG Sbjct: 251 GGGGGGAPSIGGGGGGGAPSVGGGGGGGAPSV-----GGGGGGGAPSVGGGGGG 299 Score = 34.7 bits (76), Expect = 4.2 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 46 GPXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G S G G P GGG GG P GGGG P GGGG Sbjct: 262 GGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSV-----GGGGGGGAPSVGGGGGG 310 Score = 34.7 bits (76), Expect = 4.2 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 46 GPXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G S G G P GGG GG P GGGG P GGGG Sbjct: 273 GGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSV-----GGGGGGGAPSVGGGGGG 321 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG P GGGGAP GGGG Sbjct: 249 GGGGGGG---GAPSIGGGGGGGAPSVGGGGGG 277 >UniRef50_A0FSR5 Cluster: SH3, type 3; n=1; Burkholderia phymatum STM815|Rep: SH3, type 3 - Burkholderia phymatum STM815 Length = 332 Score = 39.1 bits (87), Expect = 0.20 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 P PP GAP P GG GPP PPP GP Sbjct: 272 PGPPPGQMGAPAPGHAPAQGGRPPGPPAAPPPARPAGP 309 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 P PP G P P GG GPP PP GP Sbjct: 272 PGPPPGQMGAPAPGHAPAQGGRPPGPPAAPPPARPAGP 309 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 39.1 bits (87), Expect = 0.20 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P + P P Sbjct: 197 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 250 Score = 39.1 bits (87), Expect = 0.20 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P + P P Sbjct: 497 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 550 Score = 38.3 bits (85), Expect = 0.34 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P + P P Sbjct: 202 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 255 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 192 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 245 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 383 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 436 Score = 37.5 bits (83), Expect = 0.60 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P SP P Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 541 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 330 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 379 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP +PPPP PPP PPP P P Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 390 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP +PPPP PPP PP P P PPS Sbjct: 393 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 443 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP +PPPP PPP PPP P P Sbjct: 403 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 444 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 493 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP +PPPP PPP PPP P P Sbjct: 463 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 504 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 339 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 392 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP PPP PPP P P SP Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 423 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 393 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 446 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPP PPPP PPP PPP P P PPS Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 477 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 506 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PPP PPP P P PP Sbjct: 245 PPPPSPPPPSPPPPPPP-SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP +PPPP PPP PPP P P PPS Sbjct: 258 PPPPSPPPPSPPPPSPPPP--PPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 306 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP PPPP PPP PPP P P + P P Sbjct: 273 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 325 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP +PPPP PPP PPP P P PPS Sbjct: 315 PPPPSPPPPSPPPPSPPPP--PPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 363 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 330 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 383 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP +PPPP PPP PPP P P PPS Sbjct: 359 PPPPSPPPPSPPPPSPPPP--PPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 407 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 497 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP +PPPP PPP PPP P P PPS Sbjct: 473 PPPPSPPPPSPPPPSPPPP--PPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 521 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 P PP PPPP PPP PPP P P + P P Sbjct: 388 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 441 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP-PXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PP P PPP P P PP Sbjct: 398 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PP P P SP P Sbjct: 403 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 456 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PPP PPP P P PP Sbjct: 408 PPPPSPPPPSPPPPSPPP-PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 456 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 P PP PPPP PPP PPP P P + P P Sbjct: 502 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 555 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P + P P Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPP--PPPPSPPPPSPPPPSPPPPPPPSPPPPSP 268 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP-PXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PP P P P + P P Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 403 Score = 34.7 bits (76), Expect = 4.2 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP-PXXXGGPXFXPXXRXVIPPS 53 PPPP PPPP PPP PP P P P PPS Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 487 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP-PXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PP P P P + P P Sbjct: 463 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 517 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP P PP PPP PPP P P + P P Sbjct: 290 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 343 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PP P PPP PPP P P SP P Sbjct: 325 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 378 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PP P PPP PPP P P SP P Sbjct: 439 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 492 Score = 33.9 bits (74), Expect = 7.4 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P + P P Sbjct: 222 PPPPSPPPPSPPPPSPPPPP--PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 273 Score = 33.9 bits (74), Expect = 7.4 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 245 PPPPSPPPPSPPPPPPP-SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 297 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP PP PPP P P SP Sbjct: 310 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 359 Score = 33.9 bits (74), Expect = 7.4 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P + P P Sbjct: 338 PPPPPPPSPPPPPPPSPP----PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 387 Score = 33.9 bits (74), Expect = 7.4 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P + P P Sbjct: 452 PPPPPPPSPPPPPPPSPP----PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 501 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 212 PPPPSPPPPSPPPPSPPPPSPPPPSPPP--PPPPSPPPPSPPPPSPPPPPPPSP 263 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PP P PPP PPP P P PP Sbjct: 268 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP 317 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 P PP +PPPP PPP PPP P P Sbjct: 305 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 346 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP-PXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PP P PPP P P PP Sbjct: 310 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 360 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP-PXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PP P PPP P P PP Sbjct: 354 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 404 Score = 33.5 bits (73), Expect = 9.8 Identities = 22/83 (26%), Positives = 22/83 (26%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP PPPP PP P PPP Sbjct: 391 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 450 Query: 121 XPPPXXXGGPXFXPXXRXVIPPS 53 PPP P P PPS Sbjct: 451 SPPPPPPPSPP-PPPPPSPPPPS 472 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP-PXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PP P PPP P P PP Sbjct: 468 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 518 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 496 PPPPPPPSPPPPPPPSPP----PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 545 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 39.1 bits (87), Expect = 0.20 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP PPPP PPP PPP P P PPS Sbjct: 176 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 226 Score = 38.3 bits (85), Expect = 0.34 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P + P P Sbjct: 202 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 255 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP PPPP PPP PPP P P P P Sbjct: 192 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 245 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P + P P Sbjct: 201 PPPPPPPSPPPPPPPSPP----PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 250 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PP P P P P Sbjct: 176 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 229 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 P PP +PPPP PP PPP P P PPS Sbjct: 181 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS 231 Score = 33.5 bits (73), Expect = 9.8 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P SP P Sbjct: 191 PPPPSPPPPSPPPPPPP---SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 241 >UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-PA - Drosophila melanogaster (Fruit fly) Length = 993 Score = 39.1 bits (87), Expect = 0.20 Identities = 24/69 (34%), Positives = 27/69 (39%), Gaps = 3/69 (4%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXX---GGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLT 35 PPPP G PPPP G G P PPP GP P PP + LT Sbjct: 448 PPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPQFAALT 507 Query: 34 AXPSXSXVQ 8 + S + Q Sbjct: 508 SSSSHAHSQ 516 Score = 35.1 bits (77), Expect = 3.2 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP-----PXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G PP P PPP GP P PP Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 490 Score = 35.1 bits (77), Expect = 3.2 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP---XXPPPXXGGPXFXPXXXEXN 63 PPPP G PPPP G G PPP PPP G P N Sbjct: 437 PPPPSGNYGPPPPPP--SGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGN 485 Score = 34.3 bits (75), Expect = 5.6 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPP G GPPP PPP GP P PP Sbjct: 435 PPPPPPSGNYGPPPPPPSGN---YGPPP-PPPSGNYGPPPPPSGNYGPPP 480 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPPP G GPPP PP GP Sbjct: 469 PPPPSGNYGPPPPP------SGNYGPPP--PPSGNYGP 498 >UniRef50_A5DSH8 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 1940 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP PPPP G G PPP PPP Sbjct: 1263 PPPPPPPPPPPPPGLSVGSNIAGPPPPPPPP 1293 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPP PPPP G G PPP PPP Sbjct: 1263 PPPPPPPPPPPPPGLSVGSNIAGPPPPPPPPP 1294 >UniRef50_P28702 Cluster: Retinoic acid receptor RXR-beta; n=240; Coelomata|Rep: Retinoic acid receptor RXR-beta - Homo sapiens (Human) Length = 533 Score = 39.1 bits (87), Expect = 0.20 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 200 PPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PP G P PP GG G PPP PP G F SP P A Sbjct: 96 PPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSPFPVISSSMGSPGLPPPA 149 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 38.7 bits (86), Expect = 0.26 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKL 38 PPPP PPPP PPP PPP P P PPS L L Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPL 293 Score = 37.9 bits (84), Expect = 0.45 Identities = 21/63 (33%), Positives = 22/63 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPPP PPP PPP P P +P A P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATVAPP 303 Query: 25 SXS 17 S S Sbjct: 304 STS 306 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 38.7 bits (86), Expect = 0.26 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP PPP PPP P P SP Sbjct: 2722 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSP 2771 Score = 37.1 bits (82), Expect = 0.79 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP +PPPP PPP PPP P P PPS Sbjct: 2257 PPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPP-PPS 2306 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 2277 PPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQP 2318 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP PPP PPP P P SP Sbjct: 2693 PPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2742 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP PPP PPP P P SP Sbjct: 2698 PPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2747 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P SP P Sbjct: 2727 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSP 2780 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP +PPPP PPP PPP Sbjct: 2545 PPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPP 2576 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 2717 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2758 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PP P P PP Sbjct: 207 PPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPP 256 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 2257 PPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPP 2298 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PP P P + P P Sbjct: 2732 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSP 2785 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP PPP PPP Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPP 237 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 209 PPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPP 250 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P + P P Sbjct: 2670 PPPPPSPPPSPPPPSPPPSPP-PSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSP 2722 Score = 34.7 bits (76), Expect = 4.2 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP---PXXXGGPXFXPXXRXVIPPS 53 PPPP +PPPP PPP PP P P P PPS Sbjct: 2693 PPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 2746 Score = 34.7 bits (76), Expect = 4.2 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP---PXXXGGPXFXPXXRXVIPPS 53 PPPP +PPPP PPP PP P P P PPS Sbjct: 2698 PPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 2751 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPP PPP PPP P P SP Sbjct: 2708 PPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2757 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSR 50 PPPP +PPPP PPP PPP P P P R Sbjct: 216 PPPPPPPPPSPPPPSPPPPP-PPSPPPPSPPPPPPPSPPPPPPPPLPTPTGR 266 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP PPPP PPP PPP P P S GP Sbjct: 222 PPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTPTGRSCFSYAIGP 275 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP PPP PP P P Sbjct: 2277 PPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQP 2318 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 P PP PPPP PPP PPP P P + P P Sbjct: 2535 PSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYPP 2588 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPP PPPP PPP PPP P P SP Sbjct: 2689 PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSP 2737 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP +PPPP PPP PP P P Sbjct: 2717 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2758 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 P PP PPPP PPP PPP P P SP Sbjct: 2683 PSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSP 2732 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPP PPP PPP P P SP Sbjct: 2703 PPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2752 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PP PPP P P PP Sbjct: 205 PPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPP 254 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXV 65 PPP PPPP PPP PPP P P V Sbjct: 2278 PPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPPPCHQV 2324 >UniRef50_A5UTQ5 Cluster: Putative uncharacterized protein; n=2; Roseiflexus|Rep: Putative uncharacterized protein - Roseiflexus sp. RS-1 Length = 478 Score = 38.7 bits (86), Expect = 0.26 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Frame = -1 Query: 205 PPPPXXXXGAPP--PPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPP G PP PP GG G PP PPP G P +PPS Sbjct: 176 PPPAGGGFGLPPAAPPTTPSAGGGFGVPPSPPPPAGGGAGRLPP-----VPPS 223 Score = 38.7 bits (86), Expect = 0.26 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXPP--PPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP G PP PP GGG G PP PPP GG P Sbjct: 176 PPPAGGGFGLPPAAPPTTPSAGGGFG-VPPSPPPPAGGGAGRLP 218 Score = 36.7 bits (81), Expect = 1.0 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = -3 Query: 206 PPPPXXXXGXPP--PPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 P P G PP PP GGG G PP PPP GG P +P G Sbjct: 145 PSPAGGSFGLPPAAPPTTPSAGGGFGLPPS--PPPPAGGGFGLPPAAPPTTPSAG 197 Score = 34.3 bits (75), Expect = 5.6 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -1 Query: 205 PPPPXXXXGAPP--PPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 P P G PP PP GG G PP PPP GG P P + G Sbjct: 145 PSPAGGSFGLPPAAPPTTPSAGGGFG-LPPSPPPPAGGGFGLPPAAPPTTPSAGG 198 >UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabidopsis thaliana|Rep: Similarity to pherophorin - Arabidopsis thaliana (Mouse-ear cress) Length = 1004 Score = 38.7 bits (86), Expect = 0.26 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP G PPPP GGPPP PPP Sbjct: 680 PPPPPPPGGGPPPPPG-------GGPPPPPPP 704 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP G PPPP GGPPP PPP Sbjct: 680 PPPPPPPGGGPPPPPG-------GGPPPPPPPP 705 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP G PPP GGG PPP PPP G Sbjct: 679 PPPPPPPPGGGPPP--PPGGGP---PPPPPPPGALG 709 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +1 Query: 82 GXXXGPPXXGGGXX---GGGPPXPPPPXXXXGGG 174 G PP GGG GGGPP PPPP G G Sbjct: 678 GPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRG 711 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = -1 Query: 196 PXXXXGAPPPPXXXXGGGXX---GGPPPXPPP 110 P G PPPP GGG GG PP PPP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 124 GGGPPXPPPPXXXXGGGGXPXXXXGG 201 GGGPP PPPP GGG P GG Sbjct: 676 GGGPPPPPPPP----GGGPPPPPGGG 697 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 38.7 bits (86), Expect = 0.26 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 229 PPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 38.3 bits (85), Expect = 0.34 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P SP P Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 38.3 bits (85), Expect = 0.34 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P + P P Sbjct: 229 PPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIP 59 PPPP PPPP PPP PPP P P V P Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSR 50 PPPP PPPP PPP PPP P P + P + Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQ 307 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAY 36 PPP PPPP PPP PPP P P P P Y Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVY 304 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PPP PPP P P PP Sbjct: 228 PPPPPSPPPSPPPPPPPP----PPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPP PPPP PPP PPP P P PP Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 >UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamydomonas reinhardtii|Rep: Cell wall glycoprotein GP2 - Chlamydomonas reinhardtii Length = 1226 Score = 38.7 bits (86), Expect = 0.26 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP PPP PPP P P SP Sbjct: 983 PPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSP 1032 Score = 37.5 bits (83), Expect = 0.60 Identities = 17/51 (33%), Positives = 21/51 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP +PPP PPP PPP P + P +PP+ Sbjct: 1003 PPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPPVARLPPWPPLPVNNVPPA 1053 Score = 37.1 bits (82), Expect = 0.79 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPX-PPPXXXGGPXFXPXXRXVIPPSRGLKLTAX 29 PPPP +PPPP PPP PPP P P PP +L Sbjct: 983 PPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPPVARLPPW 1042 Query: 28 P 26 P Sbjct: 1043 P 1043 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPP +PPPP PPP PP P P PPS Sbjct: 974 PPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPS 1023 >UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG21491; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG21491 - Caenorhabditis briggsae Length = 429 Score = 38.7 bits (86), Expect = 0.26 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PP P G+PPPP G G PP PPP G P Sbjct: 305 PPRPSGAPGSPPPPPP--SGAPPTGSPPPPPPQSGGSP 340 Score = 37.1 bits (82), Expect = 0.79 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PP P G PPPP G G PPP PPP GG P SP P Sbjct: 305 PPRPSGAPGSPPPP-PPSGAPPTGSPPP--PPPQSGGSP-PPGAPPSGSPPPRP 354 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGG-GXGGPPPXXPPPXXGG 96 PPPP G PPPP GG G PP PPP G Sbjct: 317 PPPPSGAPPTGSPPPPPPQSGGSPPPGAPPSGSPPPRPSG 356 Score = 34.3 bits (75), Expect = 5.6 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXX---GGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPP G+PPP GG G PP P P GP V PP Sbjct: 340 PPPGAPPSGSPPPRPSGAPPAGGSPPTGSPPPPSPQGGAGPRGKRQVSGVQPP 392 >UniRef50_Q5CVD5 Cluster: Putative uncharacterized protein; n=2; Cryptosporidium|Rep: Putative uncharacterized protein - Cryptosporidium parvum Iowa II Length = 546 Score = 38.7 bits (86), Expect = 0.26 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = -3 Query: 206 PPP--PXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PPP P G P PP G GPPP PP GP E + GP A Sbjct: 424 PPPKGPPAPKGPPGPPSESEGSPASKGPPPSKGPPAPKGPPGPSSESEGSPATKGPPA 481 >UniRef50_A2F4E1 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 479 Score = 38.7 bits (86), Expect = 0.26 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPPP GGGG P P PP P Sbjct: 372 PPPPPPPAGLPPPP--KTGGGGPIAPKPKAAPPPPPKP 407 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP G PPPP GG P PPP Sbjct: 372 PPPPPPPAGLPPPPKTGGGGPIAPKPKAAPPP 403 >UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing protein; n=2; Eukaryota|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1189 Score = 38.7 bits (86), Expect = 0.26 Identities = 21/61 (34%), Positives = 23/61 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP G PPPP G PPP PP P PP+ GL P Sbjct: 679 PPPPPPPGGVPPPPPP-----PGGVPPPPAPPGVPAPPGVPAPPGAPAPPAPGLPKKPSP 733 Query: 25 S 23 + Sbjct: 734 A 734 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPPP GG PPP PP P Sbjct: 669 PPPPPPPGGVPPPP-PPPGGVPPPPPPPGGVPPPPAPP 705 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP G PP PP P P Sbjct: 679 PPPPPPPGGVPPPPPPPGGVPPPPAPPGVPAPPGVPAPPGAP 720 >UniRef50_Q7S7S6 Cluster: Putative uncharacterized protein NCU04267.1; n=2; Neurospora crassa|Rep: Putative uncharacterized protein NCU04267.1 - Neurospora crassa Length = 605 Score = 38.7 bits (86), Expect = 0.26 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG--PXFXPXXXEXNSPXXG 48 PPPP G PPP G G G PPP GG P F P S G Sbjct: 537 PPPPAQFTGAPPPLPPGFGPPGGGAPPPGMVGRGSGGGPPAFFPFAPPGGSAGRG 591 Score = 33.5 bits (73), Expect = 9.8 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP GAPPP G G GG P P G P PP Sbjct: 537 PPPPAQFTGAPPP--LPPGFGPPGGGAPPPGMVGRGSGGGPPAFFPFAPP 584 >UniRef50_A6RYT2 Cluster: Predicted protein; n=1; Botryotinia fuckeliana B05.10|Rep: Predicted protein - Botryotinia fuckeliana B05.10 Length = 224 Score = 38.7 bits (86), Expect = 0.26 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 93 GPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GPP G GGGPP PPP G P GG Sbjct: 169 GPPPSNGSNNGGGPPPGPPPSSNGQGNNGPSSGGPSGG 206 Score = 37.9 bits (84), Expect = 0.45 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 GPP G GGGPP PPP G P GG Sbjct: 169 GPPPSNGSNNGGGPPPGPPPSSNGQGNNGPSSGGPSGG 206 Score = 36.7 bits (81), Expect = 1.0 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = -3 Query: 206 PPPPXXXX---GXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP G PP P GGPPP PPP GP N P GP Sbjct: 115 PPPSNGSSNSGGSPPGPPPSNRPNNSGGPPPG-PPPSSSGPGNSGSNGNGNRPPPGP 170 Score = 34.3 bits (75), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP G GG PP PPP GG P Sbjct: 116 PPSNGSSNSGGSPPGPPPSNRPNNSGGPP 144 Score = 34.3 bits (75), Expect = 5.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXG 98 PP P G GGPPP PPP G Sbjct: 167 PPGPPPSNGSNNGGGPPPGPPPSSNG 192 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = -1 Query: 205 PPPPXXXX---GAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPP G+PP P GGPPP PPP G Sbjct: 115 PPPSNGSSNSGGSPPGPPPSNRPNNSGGPPPGPPPSSSG 153 >UniRef50_A3LN86 Cluster: Protein involved in actin organization and endocytosis; n=2; Saccharomycetales|Rep: Protein involved in actin organization and endocytosis - Pichia stipitis (Yeast) Length = 1373 Score = 38.7 bits (86), Expect = 0.26 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PP P G PPP PPP G P Sbjct: 1293 PPPPPPPPGPPPIPNAPFGAPPPPPPPPGPPPPVSNGVTAPP 1334 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PP P G PPP PPP G P Sbjct: 1293 PPPPPPPPGPPPIPNAPFGAPPPPPPPPGPPPPVSNGVTAPP 1334 >UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2 - Homo sapiens (Human) Length = 1865 Score = 38.7 bits (86), Expect = 0.26 Identities = 26/87 (29%), Positives = 26/87 (29%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G G PPPP PPPP PPP G G Sbjct: 1214 GAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGI- 1272 Query: 136 GGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PP PP G P P R IPP Sbjct: 1273 ---PPPPPLPGAGIPPPPPLPRVGIPP 1296 Score = 38.3 bits (85), Expect = 0.34 Identities = 23/60 (38%), Positives = 24/60 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYSXT 27 PPPP G PPPP G G P P PPP G P P + P P S T Sbjct: 1340 PPPPLPGAGIPPPPPLP-GMGIPPAPAPPLPPPGTGIP--PPPLLPVSGPPLLPQVGSST 1396 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP G PPPP G PP PPP Sbjct: 1340 PPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPP 1371 Score = 36.3 bits (80), Expect = 1.4 Identities = 27/94 (28%), Positives = 27/94 (28%), Gaps = 7/94 (7%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G G PPPP PPPP PPP G G Sbjct: 1082 GAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1141 Query: 136 GGPP------PXPPPXXXGG-PXFXPXXRXVIPP 56 PP P PPP G P P IPP Sbjct: 1142 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPP 1175 Score = 36.3 bits (80), Expect = 1.4 Identities = 27/94 (28%), Positives = 27/94 (28%), Gaps = 7/94 (7%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G G PPPP PPPP PPP G G Sbjct: 1115 GAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1174 Query: 136 GGPP------PXPPPXXXGG-PXFXPXXRXVIPP 56 PP P PPP G P P IPP Sbjct: 1175 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPP 1208 Score = 36.3 bits (80), Expect = 1.4 Identities = 27/94 (28%), Positives = 27/94 (28%), Gaps = 7/94 (7%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G G PPPP PPPP PPP G G Sbjct: 1148 GAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1207 Query: 136 GGPP------PXPPPXXXGG-PXFXPXXRXVIPP 56 PP P PPP G P P IPP Sbjct: 1208 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPP 1241 Score = 36.3 bits (80), Expect = 1.4 Identities = 27/94 (28%), Positives = 27/94 (28%), Gaps = 7/94 (7%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G G PPPP PPPP PPP G G Sbjct: 1181 GAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1240 Query: 136 GGPP------PXPPPXXXGG-PXFXPXXRXVIPP 56 PP P PPP G P P IPP Sbjct: 1241 PPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPP 1274 Score = 36.3 bits (80), Expect = 1.4 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP G PPPP G PP PP G P P IPP L P Sbjct: 1241 PPPPLPGVGIPPPPPLPGAG-----IPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIP 1295 Score = 35.5 bits (78), Expect = 2.4 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G PPPP G PP PP G P P IPP Sbjct: 1285 PPPPLPRVGIPPPPPL-----PGAGIPPPPPLPGAGIPPPPPLPGVGIPP 1329 Score = 35.5 bits (78), Expect = 2.4 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G G PPPP PPPP PPP G G Sbjct: 1302 GAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIP 1361 Query: 136 GGPPPXPPPXXXGGP 92 P P PP G P Sbjct: 1362 PAPAPPLPPPGTGIP 1376 Score = 34.3 bits (75), Expect = 5.6 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-----XXPPPXXGGPXFXP 81 PPPP G PPPP G G PPP PPP G P Sbjct: 1120 PPPPLPGAGIPPPPPLP--GAGIPPPPPLPGAGIPPPPPLPGAGIPP 1164 Score = 34.3 bits (75), Expect = 5.6 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-----XXPPPXXGGPXFXP 81 PPPP G PPPP G G PPP PPP G P Sbjct: 1153 PPPPLPGAGIPPPPPLP--GAGIPPPPPLPGAGIPPPPPLPGAGIPP 1197 Score = 34.3 bits (75), Expect = 5.6 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-----XXPPPXXGGPXFXP 81 PPPP G PPPP G G PPP PPP G P Sbjct: 1186 PPPPLPGAGIPPPPPLP--GAGIPPPPPLPGAGIPPPPPLPGAGIPP 1230 Score = 34.3 bits (75), Expect = 5.6 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-----XXPPPXXGGPXFXP 81 PPPP G PPPP G G PPP PPP G P Sbjct: 1219 PPPPLPGAGIPPPPPLP--GAGIPPPPPLPGVGIPPPPPLPGAGIPP 1263 Score = 33.9 bits (74), Expect = 7.4 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-----XXPPPXXGGPXFXP 81 PPPP G PPPP G G PPP PPP G P Sbjct: 1285 PPPPLPRVGIPPPPPLP--GAGIPPPPPLPGAGIPPPPPLPGVGIPP 1329 Score = 33.5 bits (73), Expect = 9.8 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G PPPP G G P PP G P P IPP Sbjct: 1054 PPPPLPGAGIPPPPPL-PGAGIL----PLPPLPGAGIPPPPPLPGAAIPP 1098 >UniRef50_P22357 Cluster: Anther-specific protein SF18 precursor; n=3; core eudicotyledons|Rep: Anther-specific protein SF18 precursor - Helianthus annuus (Common sunflower) Length = 161 Score = 38.7 bits (86), Expect = 0.26 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +3 Query: 93 GPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G P GG GGG P PP GGGGAP G GG Sbjct: 120 GSPPPAGGDGGGGAP---PPAGGDGGGGAPPPAGGDGG 154 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G P GG GGG P PP GGGG P G GG Sbjct: 120 GSPPPAGGDGGGGAP---PPAGGDGGGGAPPPAGGDGG 154 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +3 Query: 96 PPXXXGGGXGGGPP---XXPPPXXXXGGGGAPXXXXGGGG 206 PP GG G PP PPP GGGGAP G GG Sbjct: 104 PPGGDGGS-GPAPPAGGGSPPPAGGDGGGGAPPPAGGDGG 142 Score = 34.7 bits (76), Expect = 4.2 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 5/58 (8%) Frame = +1 Query: 49 PXXGELXSXLXGXXXGPPXXGGGXXGGGPPXP-----PPPXXXXGGGGXPXXXXGGGG 207 P GE + PP GG G GP P PPP GGGG P G GG Sbjct: 88 PGKGEGDAPHPPPTPSPP---GGDGGSGPAPPAGGGSPPPAGGDGGGGAPPPAGGDGG 142 Score = 34.3 bits (75), Expect = 5.6 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = -1 Query: 205 PPPPXXXXGAP--PPPXXXXGGGXXGGPPPXP-PPXXXGGPXFXPXXRXVIPPSRG 47 P PP G P PP G G PPP P PP GG P PP G Sbjct: 71 PGPPPGAPGTPGTPPAPPGKGEGDAPHPPPTPSPPGGDGGSGPAPPAGGGSPPPAG 126 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP PPPP G GPPP PPP Sbjct: 587 PPPMPEMMSGPPPPPPPPMPGMMSGPPPPPPP 618 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP G GPPP PPP Sbjct: 560 PPPPMPGIMQPPPPPPMPG--MMSGPPPPPPP 589 Score = 36.3 bits (80), Expect = 1.4 Identities = 24/64 (37%), Positives = 27/64 (42%), Gaps = 3/64 (4%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG---GPXFXPXXRXVIPPSRGLKLT 35 PPPP + PPP GPPP PPP G GP P PP G+ +T Sbjct: 572 PPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPPPMPGMMSGPPPPP------PPIPGM-MT 624 Query: 34 AXPS 23 PS Sbjct: 625 GPPS 628 Score = 35.9 bits (79), Expect = 1.8 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG---GPXFXP 81 PP P G PPPP G G PPP PPP G GP P Sbjct: 588 PPMPEMMSGPPPPPPPPMPGMMSGPPPP--PPPIPGMMTGPPSPP 630 Score = 34.7 bits (76), Expect = 4.2 Identities = 27/91 (29%), Positives = 28/91 (30%), Gaps = 3/91 (3%) Frame = -1 Query: 307 GXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPP-PXXXXGAPPPPXXXXGGGXXGG 131 G PPPP PPP P G P PP G Sbjct: 582 GPPPPPPPMPEMMSGPPPPPPPPMPGMMSGPPPPPPPIPGMMTGPPSPPPPPLVATVVGP 641 Query: 130 PPPXPPPXXXGGPXF--XPXXRXVIPPSRGL 44 PPP PP GGP P PPSR + Sbjct: 642 PPPLPP----GGPAALPLPPVGGWNPPSRAM 668 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PP P G PPPP GPPP PPP G Sbjct: 574 PPMPGMMSGPPPPPPPMPEM--MSGPPPPPPPPMPG 607 Score = 33.9 bits (74), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP G PPP P GP P Sbjct: 560 PPPPMPGIMQPPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPP 601 >UniRef50_UPI00015B4AC1 Cluster: PREDICTED: similar to conserved hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to conserved hypothetical protein - Nasonia vitripennis Length = 1110 Score = 38.3 bits (85), Expect = 0.34 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PP G PP GG GGPPP PP G P P + P GP Sbjct: 653 PPHGGPPHGGPPHGGPPHGGSPYGGPPPHGGPPHGGPPLGGP--MQHGGPPHGP 704 Score = 33.5 bits (73), Expect = 9.8 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP---PXXGGPXFXPXXXEXNSPXXGP 45 PP G PP GG GGPP PP P GGP P GP Sbjct: 628 PPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGSPYGGPPPHGGP 684 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 38.3 bits (85), Expect = 0.34 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P P PPP P F R PP Sbjct: 206 PPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPP 255 Score = 36.7 bits (81), Expect = 1.0 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPP +PPPP PPP PPP P P P R L+ P Sbjct: 197 PPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPP 255 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP +PPPP PPP PPP Sbjct: 94 PPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 125 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYSXT 27 PPPP PPPP PP PPP P P + P + S T Sbjct: 137 PPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPT 196 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 P PP PPPP PPP PPP P P N P Sbjct: 187 PSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPP 236 Score = 35.1 bits (77), Expect = 3.2 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P SP P Sbjct: 72 PPPPSPPPPSPPPPSPP--SPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSP 123 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PP P PPPP PPP PPP P P + P P Sbjct: 84 PPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSP 137 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPP +PPPP PPP PPP P PPS Sbjct: 49 PPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPS 98 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 P PP PPPP PPP PPP P P PP Sbjct: 187 PSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPP 236 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = -1 Query: 205 PPPPXXXXGAPPP---PXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP PPP P G PPP PPP G P Sbjct: 225 PPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPPPGLP 265 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPP PPP PPP PPP P P PPS Sbjct: 54 PPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPS 103 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = -3 Query: 206 PPPPXXXXGXPPP---PXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPP P G PPP PPP G P Sbjct: 225 PPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPPPGLP 265 >UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|Rep: B1160F02.7 protein - Oryza sativa subsp. japonica (Rice) Length = 906 Score = 38.3 bits (85), Expect = 0.34 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP--PPXXGGPXF 87 P PP G PPPP G GG G PPP P P G P F Sbjct: 361 PRPPGPGPG-PPPPPGAAGRGGGGPPPPALPGGPRARGPPPF 401 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = -1 Query: 205 PPPPXXXXGA---PPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP A PPP G GPPP PPP P Sbjct: 321 PPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAP 361 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPP APPPP G PP PPP P PP G Sbjct: 323 PPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPG 375 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXG-GPPPXXPPPXXGGP 93 PPP PPPP G G GPPP PP P Sbjct: 323 PPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAP 361 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 P PP G PPPP G GG P PPP GGP Sbjct: 361 PRPPGPGPGPPPPPG---AAGRGGGGP--PPPALPGGP 393 >UniRef50_A2X6I7 Cluster: Putative uncharacterized protein; n=2; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 119 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPP PPP GGGG G PPP PPP Sbjct: 83 PPPSPDYYDPPPSPYYGGGGGYGKPPP--PPP 112 >UniRef50_Q00486 Cluster: Mini-collagen precursor; n=2; Hydra sp.|Rep: Mini-collagen precursor - Hydra sp Length = 186 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G P P GG G P P PP GGP Sbjct: 80 PPPPPPYPGPPGAPGPMGPPGGPGCPGPQGPPGPPGGP 117 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP G P P G G P P PP GGP Sbjct: 80 PPPPPPYPGPPGAPGPMGPPGGPGCPGPQGPPGPPGGP 117 Score = 33.5 bits (73), Expect = 9.8 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 P PP PPPP G G P P PP GGP P P GP Sbjct: 68 PAPPCMPPPPPPPPPPPPYPGPPGAPGPMGPP---GGPG-CPGPQGPPGPPGGP 117 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPP GAP P G G G P PP GGP Sbjct: 83 PPPYPGPPGAPGPMGPPGGPGCPGPQGPPGPPGGPGGP 120 >UniRef50_A7RW05 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 994 Score = 38.3 bits (85), Expect = 0.34 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 8/50 (16%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXP--------PPPXXXXGGGGXPXXXXGGGG 207 G GPP G G GGGPP P PPP GGG P GGG Sbjct: 528 GQGGGPPPPGAG-QGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGG 576 Score = 37.5 bits (83), Expect = 0.60 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G GG PPPP PPPP PPPP GGG Sbjct: 572 GQGGGPPPPGAGQGWGQPPPGAGQGWGQPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGP- 630 Query: 136 GGPPP 122 PPP Sbjct: 631 --PPP 633 Score = 33.5 bits (73), Expect = 9.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 7/49 (14%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPX-------PPPPXXXXGGGGXPXXXXGGGG 207 G GPP G G G PP PPPP GGG P G G Sbjct: 539 GQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWG 587 >UniRef50_Q7SFQ1 Cluster: Predicted protein; n=1; Neurospora crassa|Rep: Predicted protein - Neurospora crassa Length = 283 Score = 38.3 bits (85), Expect = 0.34 Identities = 21/66 (31%), Positives = 24/66 (36%), Gaps = 5/66 (7%) Frame = -1 Query: 205 PPPPXXXXGAPPPP-----XXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLK 41 PPPP G+PPPP GG PPP P P P PP+ Sbjct: 108 PPPPPASSGSPPPPPQSSVPPASSGGPSAPPPPPPSPPASSSAPSAPPASSGAPPAPPAS 167 Query: 40 LTAXPS 23 A P+ Sbjct: 168 SGAPPA 173 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = -3 Query: 206 PPPPXXXXGXPPPP----XXXXGGGGXGGPPPXXPPP 108 PPPP G PPPP GG PPP P P Sbjct: 108 PPPPPASSGSPPPPPQSSVPPASSGGPSAPPPPPPSP 144 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PP P GAPP P G PPP PP G P P Sbjct: 161 PPAPPASSGAPPAPPA--SSGSPSPPPPPHPPASTGAPSAPP 200 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PP P G PP P G PPP PP G P P Sbjct: 161 PPAPPASSGAPPAPPA--SSGSPSPPPPPHPPASTGAPSAPP 200 >UniRef50_P50552 Cluster: Vasodilator-stimulated phosphoprotein; n=21; Euteleostomi|Rep: Vasodilator-stimulated phosphoprotein - Homo sapiens (Human) Length = 380 Score = 38.3 bits (85), Expect = 0.34 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG------GGXGGPPPXXPPPXXGGP 93 PP P G PPPP G G GGPPP P P GP Sbjct: 173 PPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGP 216 Score = 37.9 bits (84), Expect = 0.45 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGG------GXXGGPPPXPPPXXXGGP 92 PP P G PPPP G G GGPPP PP GP Sbjct: 173 PPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGP 216 >UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)]; n=10; Eukaryota|Rep: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)] - Sus scrofa (Pig) Length = 676 Score = 38.3 bits (85), Expect = 0.34 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP G PPP G GPPP PPP P P GP Sbjct: 611 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPPPGP 664 Score = 37.9 bits (84), Expect = 0.45 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 2/81 (2%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 GG PPPP PPP PPPP G Sbjct: 41 GGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPGARP 100 Query: 136 --GGPPPXPPPXXXGGPXFXP 80 G PPP PPP P P Sbjct: 101 PPGPPPPGPPPPGPAPPGARP 121 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 79 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 116 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 100 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 137 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 121 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 158 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 142 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 179 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 163 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 200 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 184 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 221 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 205 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 242 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 226 PPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAP 263 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 247 PPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 284 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 268 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 305 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 289 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 326 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 310 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 347 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 331 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 368 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 352 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 389 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 373 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 410 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 464 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 501 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 485 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 522 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 506 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 543 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 527 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 564 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 548 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 585 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 569 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 606 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G GPPP PPP P Sbjct: 590 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 627 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 100 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 142 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 121 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 163 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 142 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 184 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 163 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 205 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 184 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 226 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 205 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 247 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 268 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 310 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 289 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 331 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 310 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 352 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 331 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 373 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 352 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 394 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPP G PPP G GPPP PP P P R PP Sbjct: 373 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP---PGARPPPPP 419 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 464 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 506 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 485 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 527 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 506 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 548 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 527 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 569 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 548 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 590 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 569 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 611 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGGPXFXP 80 PPP PPPP G G PPP PPP P P Sbjct: 590 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 632 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 205 PPPPXXXXGAPPP-PXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPP G PPP P G PPP PPP P P Sbjct: 247 PPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 289 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 100 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 142 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 121 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 163 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 142 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 184 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 163 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 205 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 184 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 226 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 205 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 247 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 268 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 310 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 289 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 331 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 310 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 352 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 331 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 373 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 352 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 394 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 464 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 506 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 485 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 527 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 506 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 548 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 527 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 569 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 548 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 590 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 569 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 611 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGX--GGPPPXXPPPXXGGPXFXP 81 PPP PPPP G G PPP PPP P P Sbjct: 590 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 632 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPP G PPP G GPPP PP P Sbjct: 226 PPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAP 263 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP G PP G GPPP P P P P + P GP Sbjct: 378 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP-PPPPPPADEPQQGP 430 Score = 33.5 bits (73), Expect = 9.8 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPP G G PP PPP G P P P P Sbjct: 441 PPPPA---GPPPPGPPSPGPAPPGARPPPGPPP-PGPPPPGPAPPGARPPPGPP 490 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP G PPP G GPPP P P P P Sbjct: 632 PPPGPPPPGPPPPGPAPPGARPPPGPPPPPPGPSPPRPPPGP 673 >UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda|Rep: Protein enabled homolog - Homo sapiens (Human) Length = 591 Score = 38.3 bits (85), Expect = 0.34 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP-PPXXGGPXFXPXXXEXNSPXXG 48 PPPP G PPPP PPP P PP F E N P G Sbjct: 338 PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTG 391 >UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 454 Score = 37.9 bits (84), Expect = 0.45 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 205 PPPPXXXX--GAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP GAPPPP PPP PPP P P PP Sbjct: 159 PPPPAHPAAYGAPPPPPPP--ASYAAPPPPPPPPASYAAPPPAPPASYAAPP 208 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP APPPP PPP PP P P Sbjct: 173 PPPPPASYAAPPPPPPPPAS--YAAPPPAPPASYAAPPPARP 212 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 196 PXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 P GAPPPP G PPP PPP P P Sbjct: 152 PQPSYGAPPPPAHP---AAYGAPPPPPPPASYAAPPPPP 187 >UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain binding protein; n=2; Mus musculus|Rep: PREDICTED: similar to SH3 domain binding protein - Mus musculus Length = 455 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP GAPPPP G PPP PPP Sbjct: 14 PPPPPPPLGAPPPPPL-------GAPPPPPPP 38 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPPP PPPP G PPP PP Sbjct: 7 PPPPPPPPPPPPPPLGAPPPPPLGAPPPPPPP 38 >UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 191 Score = 37.9 bits (84), Expect = 0.45 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP GA PP G PPP PP P P R PP G Sbjct: 83 PPPPPPRDGASPPAPPPRDG---SSPPPPPPRDGSSPPPPPPSKRAASPPPPG 132 Score = 36.7 bits (81), Expect = 1.0 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP PPP G P + +SP P Sbjct: 118 PPPPSKRAASPPPP------GDGSSPPP--PPPRDGSSPRPPPPRDGSSPPPPP 163 Score = 35.5 bits (78), Expect = 2.4 Identities = 22/85 (25%), Positives = 24/85 (28%) Frame = -1 Query: 310 GGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGG 131 G PPPP + PPPP G+ P P G Sbjct: 102 GSSPPPPPPRDGSSPPPPPPSKRAASPPPPGDGSSPPPPPPRDGSSPRPPPP----RDGS 157 Query: 130 PPPXPPPXXXGGPXFXPXXRXVIPP 56 PP PPP P P PP Sbjct: 158 SPPPPPPRDGSSPPPPPPRDGSAPP 182 Score = 35.1 bits (77), Expect = 3.2 Identities = 21/78 (26%), Positives = 22/78 (28%) Frame = -1 Query: 313 GGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXG 134 G PPPP K PPP +PPPP G Sbjct: 113 GSSPPPPPPSKRAASPPPPGDGSSPPPPPPRDGSSPRPPPPRDGSSPPPPPPRDGSS--- 169 Query: 133 GPPPXPPPXXXGGPXFXP 80 PP PPP P P Sbjct: 170 --PPPPPPRDGSAPPPPP 185 >UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome undetermined SCAF16309, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 283 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG--GGXGGPPPXXPPPXXGGP 93 PPPP G PPPP G G G PP PPP P Sbjct: 240 PPPPMTGSGFPPPPPLNHSGSTGRLGRLPPPPPPPPPPPP 279 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP G PPPP GG P PPP GG Sbjct: 165 PPPPATGIGFPPPPPPPVPGGV---SVPPPPPLAPGG 198 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPPP G PPPP GG PPP P Sbjct: 165 PPPPATGIGFPPPPPPPVPGGVSVPPPPPLAP 196 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 5/38 (13%) Frame = -3 Query: 206 PPPPXXXXG---XPPPPXXXXGGGGXGG--PPPXXPPP 108 PPPP G PPPP G G G PPP PPP Sbjct: 238 PPPPPPMTGSGFPPPPPLNHSGSTGRLGRLPPPPPPPP 275 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -1 Query: 205 PPPPXXXXG-APPPPXXXXGG-GXXGGPPPXPPP 110 PPPP G PPPP G G G PP PPP Sbjct: 240 PPPPMTGSGFPPPPPLNHSGSTGRLGRLPPPPPP 273 >UniRef50_Q47LM4 Cluster: Putative uncharacterized protein; n=1; Thermobifida fusca YX|Rep: Putative uncharacterized protein - Thermobifida fusca (strain YX) Length = 716 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/48 (37%), Positives = 21/48 (43%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 P PP G G GPPP PP GP P + P GP A++ Sbjct: 215 PQPPQGQPGPGQPPGPPPRQAPP--AGPPLPPAGAAPSGPQQGPAAWN 260 >UniRef50_A7INX6 Cluster: Putative head morphogenesis protein SPP1 gp7; n=1; Xanthobacter autotrophicus Py2|Rep: Putative head morphogenesis protein SPP1 gp7 - Xanthobacter sp. (strain Py2) Length = 572 Score = 37.9 bits (84), Expect = 0.45 Identities = 22/66 (33%), Positives = 26/66 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP APPPP G PP P P G P R V+P S A P Sbjct: 251 PPPPPAAPAAPPPPPASDPGPVLVMPPVPPAP----GVPIPPPPRGVVPRSPAPARPAPP 306 Query: 25 SXSXVQ 8 + ++ Sbjct: 307 AGQPIR 312 >UniRef50_A3TRM3 Cluster: Putative uncharacterized protein; n=1; Janibacter sp. HTCC2649|Rep: Putative uncharacterized protein - Janibacter sp. HTCC2649 Length = 136 Score = 37.9 bits (84), Expect = 0.45 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXG--GGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPP G GGG G PPP P GG P Sbjct: 10 PPPPPGDGGSTPPPPSGGGYDGGGYGAPPP--PAGGYGGVPAGP 51 Score = 37.1 bits (82), Expect = 0.79 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXG--GGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKL 38 PPPP G+ PPP G GG G PP PP GG P PPS L L Sbjct: 10 PPPPPGDGGSTPPPPSGGGYDGGGYGAPP--PPAGGYGGVPAGP------PPSNNLIL 59 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGG 171 G PP GGG GGG PPPP GG Sbjct: 17 GGSTPPPPSGGGYDGGGYGAPPPPAGGYGG 46 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P P PP Sbjct: 220 PPPPPPPPSPPPPPPPPP---PPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PPP PPP P P PP Sbjct: 231 PPPPPPPPPSPPPPPPPP---PPPSPPPPPPPPSPSPPPPPPSPSPPPPP 277 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PP PPP P P + P P Sbjct: 234 PPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPP 287 Score = 33.9 bits (74), Expect = 7.4 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPPP PPP P P P P PP P Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Query: 25 SXS 17 S S Sbjct: 270 SPS 272 Score = 33.9 bits (74), Expect = 7.4 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P + P P Sbjct: 221 PPPPPPPSPPPPPPPPP-----PPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 33.5 bits (73), Expect = 9.8 Identities = 20/74 (27%), Positives = 21/74 (28%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP PPPP +PPPP PPP Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP----SPSPPPPP 277 Query: 121 XPPPXXXGGPXFXP 80 PP P F P Sbjct: 278 PPPSPPPAPPPFVP 291 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 37.9 bits (84), Expect = 0.45 Identities = 22/63 (34%), Positives = 24/63 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP AP PP PPP PPP P P PPS L++ P Sbjct: 856 PPPPPNPPPAPTPPPPP---SPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPP 912 Query: 25 SXS 17 S Sbjct: 913 PLS 915 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP PPPP P P PPP P P PPS Sbjct: 799 PPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPS 849 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPP PPPP PPP PPP P N P P S Sbjct: 858 PPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLS 915 Score = 34.3 bits (75), Expect = 5.6 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P SP P Sbjct: 805 PPPPPPPPSPPPPPNPPT---PPSPPPPPSPPPPPSSPP-PPSPSPPPSPPPAP 854 >UniRef50_Q9VC23 Cluster: CG7016-PA; n=2; Sophophora|Rep: CG7016-PA - Drosophila melanogaster (Fruit fly) Length = 362 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PP P G PPPP G GGPPP P GGP Sbjct: 166 PPRPGFNGGGPPPPRPGWNG---GGPPPPMPGWNGGGP 200 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PP P G PPPP G GGPPP P GGP Sbjct: 178 PPRPGWNGGGPPPPMPGWNG---GGPPPPRPGWNGGGP 212 Score = 37.1 bits (82), Expect = 0.79 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PP P G PPPP GG G PPP P G P P PP Sbjct: 166 PPRPGFNGGGPPPPRPGWNGG--GPPPPMPGWNGGGPPPPRPGWNGGGPP 213 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 GPP G GGGPP PP P GG P GGG Sbjct: 175 GPPPPRPGWNGGGPP-PPMPGWNGGGPPPPRPGWNGGG 211 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PP P G PPPP GG GPPP P P GG Sbjct: 190 PPMPGWNGGGPPPPRPGWNGG---GPPP-PRPGWNGG 222 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G GP G G GGG PPP GGG P GG Sbjct: 145 GGGQGPGWNGPGWNGGGGRGPPPRPGFNGGGPPPPRPGWNGG 186 Score = 34.7 bits (76), Expect = 4.2 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G GPP G GGGPP PP P GG P GGG Sbjct: 160 GGGRGPPPRPG-FNGGGPP-PPRPGWNGGGPPPPMPGWNGGG 199 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP 114 PP P G PPPP G GGPPP P Sbjct: 190 PPMPGWNGGGPPPPRPGWNG---GGPPPPRP 217 >UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 1115 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PP P GAPPPP GGPPP PPP Sbjct: 566 PPLPQNLSGAPPPPPPPPP--MLGGPPPPPPP 595 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PP P G PPPP GGPPP PPP Sbjct: 566 PPLPQNLSGAPPPPPPPPPM--LGGPPPPPPPP 596 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPP PPP GGP P Sbjct: 562 PPPPPPLPQNLSGAPPPPPPPPPMLGGPPPPP 593 >UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1300 Score = 37.9 bits (84), Expect = 0.45 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 P PP PPPP GG P P PPP G P P GL Sbjct: 600 PAPPPGLPPPPPPPGYKAGGSASSAPLPPPPPPPGGSGVSSPPAGLPPPHPPGL 653 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 P PP PPPP GG P P PPP G P Sbjct: 600 PAPPPGLPPPPPPPGYKAGGSASSAPLPPPPPPPGGSGVSSP 641 Score = 34.7 bits (76), Expect = 4.2 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 13/63 (20%) Frame = -1 Query: 205 PPPPXXXXGA-------PPPPXXXXGGG----XXGGPPPXPP--PXXXGGPXFXPXXRXV 65 PPPP G PPPP G G G PPP PP P GGP P Sbjct: 610 PPPPGYKAGGSASSAPLPPPPPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPPP 669 Query: 64 IPP 56 PP Sbjct: 670 PPP 672 Score = 33.9 bits (74), Expect = 7.4 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 8/62 (12%) Frame = -3 Query: 206 PPPPXXXX------GXPPP--PXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXX 51 PPPP G PPP P GG PPP PPP P P N P Sbjct: 630 PPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPPPPPPPPPPPPPPPRMGNGPPP 689 Query: 50 GP 45 P Sbjct: 690 PP 691 >UniRef50_A2EJF1 Cluster: LIM domain containing protein; n=4; Trichomonas vaginalis G3|Rep: LIM domain containing protein - Trichomonas vaginalis G3 Length = 842 Score = 37.9 bits (84), Expect = 0.45 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-----XXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP G PP P G G G PPP PPP G P SP G Sbjct: 98 PPPPGSGNGLPPAPLGTGFGSGRGLPPPPGSSNGLPPPLTNGLPPPPGNGLPPSPGFG 155 >UniRef50_Q7SC37 Cluster: Predicted protein; n=1; Neurospora crassa|Rep: Predicted protein - Neurospora crassa Length = 1578 Score = 37.9 bits (84), Expect = 0.45 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXR 71 PP P PPP GG G PPP PP G P P R Sbjct: 244 PPQPPHPSQQGPPPNAHQMGGSYGIPPPRAPPVAIGPPSAFPRDR 288 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PP P PPP GG G PPP PP G P P Sbjct: 244 PPQPPHPSQQGPPPNAHQMGGSYGIPPPRAPPVAIGPPSAFP 285 >UniRef50_Q6C6N4 Cluster: Similar to DEHA0F03828g Debaryomyces hansenii; n=1; Yarrowia lipolytica|Rep: Similar to DEHA0F03828g Debaryomyces hansenii - Yarrowia lipolytica (Candida lipolytica) Length = 600 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 182 GXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 G PPPP G GG GGP P PP GGP Sbjct: 199 GGPPPPG---GPGGLGGPAPPGPPGHHGGP 225 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 181 GAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 G PPPP G G GGP P PP GGP Sbjct: 199 GGPPPPG---GPGGLGGPAPPGPPGHHGGP 225 >UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleostomi|Rep: Protein enabled homolog - Mus musculus (Mouse) Length = 802 Score = 37.9 bits (84), Expect = 0.45 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP--PPXXGGPXFXPXXXEXNSPXXG 48 PPPP G PPPP PPP P PP F E N P G Sbjct: 569 PPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAPPLPASGIFSGSTSEDNRPLTG 623 Score = 33.5 bits (73), Expect = 9.8 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP G PPPP G PPP PPP P P P+ G+ Sbjct: 562 PPPP----GPPPPPPLPSTGPPP--PPPPPPPLPNQAPPPPPPPPAPPLPASGI 609 >UniRef50_P41832 Cluster: Protein BNI1; n=2; Saccharomyces cerevisiae|Rep: Protein BNI1 - Saccharomyces cerevisiae (Baker's yeast) Length = 1953 Score = 29.9 bits (64), Expect(2) = 0.53 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 236 PPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPP F G PPP Sbjct: 1280 PPPPPPPPPPPPMALFGKPKGETPPPP 1306 Score = 26.6 bits (56), Expect(2) = 0.53 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 233 PPPPPPPP 256 PPPPPPPP Sbjct: 1239 PPPPPPPP 1246 >UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous 1; n=1; Monodelphis domestica|Rep: PREDICTED: similar to diaphanous 1 - Monodelphis domestica Length = 1186 Score = 37.5 bits (83), Expect = 0.60 Identities = 21/57 (36%), Positives = 22/57 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAY 36 PPPP PPP G G PP PPP GGP P P P A+ Sbjct: 610 PPPPPPPLPVLPPPSPLPLPGSTGIPP---PPPLLGGPGIPPPLPGMCLPPPPPPAF 663 >UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1465 Score = 37.5 bits (83), Expect = 0.60 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -1 Query: 205 PPPPXXXXG-APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP G APPPP G PPP PPP P P PP G+ Sbjct: 963 PPPPPPLPGMAPPPPPPFPG---MTPPPPPPPPGCGPPPPPLPPGIGPPPPFMGM 1014 Score = 35.5 bits (78), Expect = 2.4 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGP------PPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G P PP PPP GP P + PP Sbjct: 953 PPPPPLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPPPPPGCGPPPPPLPPGIGPP 1008 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPP G PPP PPP G P Sbjct: 963 PPPPPPLPGMAPPPPPPFPG---MTPPPPPPPPGCGPP 997 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPP G GPPP PP G P Sbjct: 974 PPPPPPFPGMTPPPPPPPPG---CGPPPPPLPPGIGPP 1008 >UniRef50_UPI0000498407 Cluster: hypothetical protein 13.t00006; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 13.t00006 - Entamoeba histolytica HM-1:IMSS Length = 510 Score = 37.5 bits (83), Expect = 0.60 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP PP G P P NS P Sbjct: 373 PPPPTAPMMDNIPPPPPVAPAIGNPPPPPPIAPPKQAGNPPPPPPIRSTNSAGNPP 428 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP---PXXXGGPXFXPXXRXVIPPS 53 PPP G PPPP G PPP PP G P P R P+ Sbjct: 387 PPPVAPAIGNPPPPPPIAPPKQAGNPPPPPPIRSTNSAGNPPPPPPARQTAAPA 440 >UniRef50_A0GMB5 Cluster: SH3, type 3 precursor; n=2; Burkholderia|Rep: SH3, type 3 precursor - Burkholderia phytofirmans PsJN Length = 316 Score = 37.5 bits (83), Expect = 0.60 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP GA PP G G PP PPP GG Sbjct: 138 PPPPPPRPGAGWPPGGRPPGHDGGRPPGGPPPGHGGG 174 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PP G GG PP PPP GG Sbjct: 138 PPPPPPRPGAGWPPGGRP-PGHDGGRPPGGPPPGHGG 173 >UniRef50_Q6ET12 Cluster: Putative uncharacterized protein P0463G12.21; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein P0463G12.21 - Oryza sativa subsp. japonica (Rice) Length = 249 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 112 GGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 GG GGG P PP P GGG GGGG Sbjct: 155 GGEAGGGSPPPPSPPNLAGGGRGEAGGGGGGG 186 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 109 GGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 GG GG PP P PP GG G GGG Sbjct: 155 GGEAGGGSPPPPSPPNLAGGGRGEAGGGGGGG 186 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 37.5 bits (83), Expect = 0.60 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPMSP 295 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP PPP PPP P P Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLP 282 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLP 282 >UniRef50_Q54TI7 Cluster: WH2 domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: WH2 domain-containing protein - Dictyostelium discoideum AX4 Length = 459 Score = 37.5 bits (83), Expect = 0.60 Identities = 21/52 (40%), Positives = 22/52 (42%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PP PPPP GGG P PPP GGP P R PP+ G Sbjct: 277 PPTQPPMNRPPPPGPN-GGGPPQPPISRPPPPNPGGPPQPPISRPP-PPNPG 326 Score = 37.5 bits (83), Expect = 0.60 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 8/68 (11%) Frame = -1 Query: 205 PPPPXXXXGAPP-PPXXXXGGGXXGGP-------PPXPPPXXXGGPXFXPXXRXVIPPSR 50 PPPP G PP PP GGP PP P P GGP P R P Sbjct: 286 PPPPGPNGGGPPQPPISRPPPPNPGGPPQPPISRPPPPNPGTGGGPTQPPMNRPPPPGPN 345 Query: 49 GLKLTAXP 26 G + P Sbjct: 346 GGPMNRPP 353 Score = 37.5 bits (83), Expect = 0.60 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP-PXXPPPXXGGPXFXP 81 PPPP G P P G GGPP P PP G P P Sbjct: 352 PPPPGPNGGPPQPMNRPPPPGSNGGPPQPMSRPPPPGQPNMPP 394 Score = 34.3 bits (75), Expect = 5.6 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = -3 Query: 200 PPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP-XXGGPXFXPXXXEXNSPXXGP 45 PP PPPP GGG P PPP GGP P N P Sbjct: 312 PPQPPISRPPPPNPGTGGGPTQPPMNRPPPPGPNGGPMNRPPPPGPNGGPPQP 364 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PP PPPP GGG P PPP GGP P Sbjct: 277 PPTQPPMNRPPPPG-PNGGGPPQPPISRPPPPNPGGPPQPP 316 Score = 33.9 bits (74), Expect = 7.4 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -3 Query: 206 PPPPXXXXGXPP-PPXXXXGGGGXGGPPP---XXPPPXXGGPXFXPXXXEXNSP 57 PPPP G PP PP GGPP PPP G P N P Sbjct: 286 PPPPGPNGGGPPQPPISRPPPPNPGGPPQPPISRPPPPNPGTGGGPTQPPMNRP 339 >UniRef50_Q1HMI9 Cluster: Formin C; n=3; Trypanosoma cruzi|Rep: Formin C - Trypanosoma cruzi strain CL Brener Length = 937 Score = 37.5 bits (83), Expect = 0.60 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 182 GXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 G PPPP GG G PP PPP G N P GP A Sbjct: 472 GPPPPPPPPTSAGGKKGAPPPPPPPPSGA----KKPPNGNLPVPGPAA 515 Score = 36.7 bits (81), Expect = 1.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPP 110 PPPP GG G PPP PPP Sbjct: 475 PPPPPPTSAGGKKGAPPPPPPP 496 >UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1723 Score = 37.5 bits (83), Expect = 0.60 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP AP P G G PPP PPP G P P PP Sbjct: 1010 PPPPPPGMNAPVAP------GFGGPPPPPPPPPPPGMPGMPPPPPPPPPP 1053 Score = 36.7 bits (81), Expect = 1.0 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP PPP G GGPPP PPP G P P G Sbjct: 1007 PPPPPP----PPPGMNAPVAPGFGGPPPPPPPPPPPGMPGMPPPPPPPPPPPG 1055 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 7/44 (15%) Frame = -1 Query: 205 PPPPXXXX-------GAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP G PPPP G G PPP PPP G Sbjct: 1012 PPPPGMNAPVAPGFGGPPPPPPPPPPPGMPGMPPPPPPPPPPPG 1055 >UniRef50_Q61900 Cluster: Submaxillary gland androgen-regulated protein 1 precursor; n=4; Murinae|Rep: Submaxillary gland androgen-regulated protein 1 precursor - Mus musculus (Mouse) Length = 147 Score = 37.5 bits (83), Expect = 0.60 Identities = 21/61 (34%), Positives = 24/61 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPP G PPPP G G PPP PP P P PP+ + T P Sbjct: 51 PPPFGPGIGRPPPPPFGPGIGRPPPPPPCPPVPPHPRPPSNPSP----PPTPSIPPTGPP 106 Query: 25 S 23 + Sbjct: 107 T 107 Score = 37.1 bits (82), Expect = 0.79 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNS-PXXGP 45 PPP G PPPP G G PPP P P P P S P GP Sbjct: 51 PPPFGPGIGRPPPPPFGPGIGRPPPPPPCPPVPPHPRPPSNPSPPPTPSIPPTGP 105 >UniRef50_UPI00015B5315 Cluster: PREDICTED: similar to Heterogeneous nuclear ribonucleoprotein K; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to Heterogeneous nuclear ribonucleoprotein K - Nasonia vitripennis Length = 445 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 93 GPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G P GGG GGG P P GG G P GGG Sbjct: 166 GQPAGGGGGGGGGGPGGKPGGGFGGGRGGPPNAPPGGG 203 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G P GGG GGG P P GG G P GGG Sbjct: 166 GQPAGGGGGGGGGGPGGKPGGGFGGGRGGPPNAPPGGG 203 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 G P GGG GGGP P G GG P GGG Sbjct: 163 GENGQPAGGGGGGGGGGPGGKPGGGFGGGRGGPPNAPPGGG 203 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G GP GGG G PP GGGGA GGGG Sbjct: 283 GNGGGPGMGGGGGGGFNGNRGGPPYSGGGGGGAGGGGGGGGG 324 Score = 35.1 bits (77), Expect = 3.2 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPP--PPXXXXGG----GGXPXXXXGGGG 207 G GP GG GGG PP PP GG GG P GGGG Sbjct: 175 GGGGGPGGKPGGGFGGGRGGPPNAPPGGGPGGPMNRGGRPDNRGGGGG 222 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G + GPP GG GGP GGGG P GG G Sbjct: 190 GGRGGPPNAPPGGGPGGPMNRGGRPDNRGGGGGPDMNRGGFG 231 Score = 34.3 bits (75), Expect = 5.6 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 46 GPXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G G GP GGG G PP GGGG GGGG Sbjct: 271 GIGGGNFGGDRGGNGGGPGMGGGGGGGFNGNRGGPPYSGGGGGGAGGGGGGGGG 324 >UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, inverted; n=1; Gallus gallus|Rep: PREDICTED: similar to formin, inverted - Gallus gallus Length = 1208 Score = 37.1 bits (82), Expect = 0.79 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXV-IPP 56 PPPP G PPP G G G PPP P P G P P IPP Sbjct: 395 PPPPLPGMGGIPPPPPLPGMG--GIPPPPPLPGLGGIPPPPPLPGLAGIPP 443 Score = 35.9 bits (79), Expect = 1.8 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PPP G G G PPP P P G P P Sbjct: 407 PPPPLPGMGGIPPPPPLPGLG--GIPPPPPLPGLAGIPPPPP 446 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP 114 PPPP G PPP G GG PPP P Sbjct: 443 PPPPLPGMGGIPPPPPLSGMGGIPPPPPPLP 473 Score = 35.1 bits (77), Expect = 3.2 Identities = 23/63 (36%), Positives = 26/63 (41%), Gaps = 8/63 (12%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP-PXXXG-------GPXFXPXXRXVIPPSR 50 PPPP G PPP G G G PPP PP P G P F + PP + Sbjct: 443 PPPPLPGMGGIPPPPPLSGMG--GIPPPPPPLPGMAGDNIEAVVAPQFSCPLGFISPPRK 500 Query: 49 GLK 41 +K Sbjct: 501 AVK 503 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPP G GG PP P P GG Sbjct: 395 PPPPLPGMGGIPPPPPLP---GMGGIPPPPPLPGLGG 428 Score = 33.9 bits (74), Expect = 7.4 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPP G GG PPP P G P P P P Sbjct: 407 PPPPLPGMGGIPPPPPLPGLGGI--PPPPPLPGLAGIPPPPPLPGMGGIPPPPP 458 Score = 33.5 bits (73), Expect = 9.8 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 205 PPPPXXXXGA-PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP G G G PPP P P G P P Sbjct: 382 PPPPLPGMAVIPPPPPPLPGMG--GIPPPPPLPGMGGIPPPPP 422 >UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit; n=5; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit - Strongylocentrotus purpuratus Length = 1729 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP GA PPP G PPP PPP P Sbjct: 1648 PPPPPPPFGAAPPPPPPPCGAP---PPPPPPPPPISAP 1682 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPP G PPP PPP P Sbjct: 1648 PPPPPPPFGAAPPPPPPPCG---APPPPPPPPPPISAP 1682 >UniRef50_UPI0000E494ED Cluster: PREDICTED: similar to FIP1 like 1 (S. cerevisiae); n=2; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to FIP1 like 1 (S. cerevisiae) - Strongylocentrotus purpuratus Length = 841 Score = 37.1 bits (82), Expect = 0.79 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 12/66 (18%) Frame = -3 Query: 206 PPPPXXXXGXPP-----PPXXXXGGG---GXGGPPP----XXPPPXXGGPXFXPXXXEXN 63 PPPP G PP PP G G GGPPP PPP GGP P Sbjct: 475 PPPPMGMHGGPPPPNMGPPPMGMGRGPRPPMGGPPPMMGMQGPPPRMGGP---PPPGPHG 531 Query: 62 SPXXGP 45 P GP Sbjct: 532 PPPMGP 537 >UniRef50_Q4T4L4 Cluster: Chromosome undetermined SCAF9593, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF9593, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 335 Score = 37.1 bits (82), Expect = 0.79 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = -3 Query: 203 PPPXXXXGXPP-PPXXXXGGGGXGGPPPXXPPPXXGG-PXFXPXXXEXNSPXXGPXA 39 PPP G PP PP G GPPP PPP G P P P P A Sbjct: 76 PPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGLPPPPPRTGAPPRPLGPPMA 132 Score = 33.9 bits (74), Expect = 7.4 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 202 PPPXXXXGAPP-PPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPP G PP PP G GPPP PP G P R PP Sbjct: 76 PPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGLP-PPPPRTGAPP 124 >UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 14 SCAF15003, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1140 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PP G PPP PPP P P V PP Sbjct: 545 PPPPLPCFAGLAPPPPPLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVPPP 594 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPP G PPP G PPP PPP P P PP Sbjct: 546 PPPLPCFAGLAPPPPPLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVPPPP 595 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP G PPP PPP GGP Sbjct: 546 PPPLPCFAGLAPPPPPLPGA---MMPPPPPPPPPPGGP 580 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP GGPPP PP G P Sbjct: 558 PPPPLPGAMMPPPPPPPP---PPGGPPPPGRPPVSGVP 592 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PP P PPPP GG G PP P G P + N P Sbjct: 560 PPLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVPPPPGAPIGPSLKKKNIP 609 >UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burkholderia|Rep: Hemagglutinin domain protein - Burkholderia mallei (Pseudomonas mallei) Length = 373 Score = 37.1 bits (82), Expect = 0.79 Identities = 22/66 (33%), Positives = 24/66 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPPP PPP PPP P P PP+ T P Sbjct: 90 PPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPTTTPPT---TTTPTP 144 Query: 25 SXSXVQ 8 S +Q Sbjct: 145 SMHPIQ 150 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 90 PPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 131 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP PPP PPP P Sbjct: 99 PPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTP 136 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPP PPP PPP P P +P P Sbjct: 95 PPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPPTTTTPTPSMHP 148 Score = 34.3 bits (75), Expect = 5.6 Identities = 21/62 (33%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS-RGLKLTAX 29 PPPP +PPPP PPP PPP P P PS ++ T Sbjct: 99 PPPPPPPPPSPPPPSPP----PPSPPPPSPPPPSPPPPTTTPPTTTTPTPSMHPIQPTQL 154 Query: 28 PS 23 PS Sbjct: 155 PS 156 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNS 60 PPPP PPPP PPP PPP P P + S Sbjct: 276 PPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAPVNNDPTS 324 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP PPP P P P P N P Sbjct: 273 PPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAPVNNDP 322 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP PP PPP P P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPP 313 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIP 59 PPPP PP P PPP PPP G P R IP Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRPEIP 548 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP PPP PPP P P SP Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 Score = 35.9 bits (79), Expect = 1.8 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP PPPP PPP PPP P P V P G Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRPEIPG 549 Score = 35.1 bits (77), Expect = 3.2 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P GP Sbjct: 486 PPPPPPPPPPPPPPPPPP---SPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP PPP PPP P P Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 Score = 34.7 bits (76), Expect = 4.2 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP +PPPP PPP PPP P P I PS Sbjct: 495 PPPPPPPPPSPPPPPPP---SPPPPPPPPPPPPPPPPPPPPPPGPSPITPS 542 >UniRef50_A1UQ48 Cluster: Peptidase S8 and S53, subtilisin, kexin, sedolisin precursor; n=10; Mycobacterium|Rep: Peptidase S8 and S53, subtilisin, kexin, sedolisin precursor - Mycobacterium sp. (strain KMS) Length = 560 Score = 37.1 bits (82), Expect = 0.79 Identities = 20/73 (27%), Positives = 20/73 (27%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G G PPPP PP P PPP GG Sbjct: 156 GAGAPPPPPGVPANPAPPAFPPPPTITATATVTAPAPPPEPPPPPAEPPPGGPPPGGPPP 215 Query: 136 GGPPPXPPPXXXG 98 GPPP P G Sbjct: 216 AGPPPAQGPGDTG 228 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPP PPP GG GGPPP PPP G Sbjct: 192 PPPEPP---PPPAEPPPGGPPPGGPPPAGPPPAQG 223 >UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sativa|Rep: OSJNBb0018A10.6 protein - Oryza sativa (Rice) Length = 909 Score = 37.1 bits (82), Expect = 0.79 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 P PP APPPP GPPP PPP P P PP+ Sbjct: 445 PSPPAPSPPAPPPPPPVPS---PSGPPPPPPPPAPSPPAPPPPPPAPSPPA 492 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSR 50 PPPP PPPP PPP P P P P P +R Sbjct: 457 PPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPPPPCPPAPPKTR 508 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 P PP PPPP GPPP PPP P P + P P Sbjct: 445 PSPPAPSPPAPPPPPPVPS---PSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPP 495 >UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP3 - Nicotiana alata (Winged tobacco) (Persian tobacco) Length = 151 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/60 (30%), Positives = 23/60 (38%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXPS 23 PPP +PPPP PPP PPP P P PP+ + + P+ Sbjct: 66 PPPKREQPSPPPPVKSPPPPSPSPPPPSPPPPSPSPPPPSPSPPPPSPPADDMAPSPSPA 125 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPP PPPP PPP PPP P P + P Sbjct: 66 PPPKREQPSPPPPVKSPPPPSPSPPPPSPPPPSPSPPPPSPSPPPPSPP 114 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PP P PPPP PPP PPP P P + PPS Sbjct: 218 PPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPS 268 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP PPP PPP PPP P P PPS Sbjct: 206 PPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPS 256 Score = 35.1 bits (77), Expect = 3.2 Identities = 20/61 (32%), Positives = 22/61 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPP +PPPP PP PPP P P PPS L + P Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIP 270 Query: 25 S 23 S Sbjct: 271 S 271 >UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassified, expressed; n=5; Oryza sativa|Rep: Transposon protein, putative, unclassified, expressed - Oryza sativa subsp. japonica (Rice) Length = 892 Score = 37.1 bits (82), Expect = 0.79 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXF-XPXXRXVIPPSRGLKLTAX 29 PPPP PPPP PPP PPP P +P SR L Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLPKPAEPPAVPTSRRRLLKPL 409 Query: 28 P 26 P Sbjct: 410 P 410 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP PPP PPP Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 >UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family; n=2; Ostreococcus tauri|Rep: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family - Ostreococcus tauri Length = 872 Score = 37.1 bits (82), Expect = 0.79 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP +PPPP PPP PPP P P V+ PS Sbjct: 564 PPPPSPPPPSPPPPSPP----PPPSPPPSPPPPPSPPPPSPPPPPVVVVPS 610 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGG--XGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PP P PPPP G PPP PPP P P SP P Sbjct: 538 PPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPP 593 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PP P PPPP G PP P P P P PPS Sbjct: 538 PPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPS 588 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 P PP +PPPP PPP PPP P PPS Sbjct: 518 PSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPS 568 >UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n=5; root|Rep: Chromosome 13 contig 1, DNA sequence - Ostreococcus tauri Length = 1990 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 801 PPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPPPSPPPPSPFPPPAPPP 854 >UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 324 Score = 37.1 bits (82), Expect = 0.79 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP---XXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G G PPP PPP P P P GP Sbjct: 25 PPPPYDPFAPPPPPGPPGPPGPPGPPPPSWHHPPPPDPFAP--PPPPGPPGPPPPGP 79 Score = 34.7 bits (76), Expect = 4.2 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP-PXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PPPP G P PP PP P PPP G P P GP A Sbjct: 34 PPPPPGPPGPPGPPGPPPPSWHHPPPPDPFAPPPPPGPPGPPPPGPYSPPAPPGPPA 90 Score = 33.9 bits (74), Expect = 7.4 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PPP G PPPP PPP PP GP P + P P A Sbjct: 16 PPPPGPPGRPPPPYDPF------APPPPPGPPGPPGPPGPPPPSWHHPPPPDPFA 64 >UniRef50_A5AVJ0 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 427 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP PPPP G PP PPP G Sbjct: 310 PPPPQAPPPPPPPPQGLPPGATIANPPRGPPPPMPG 345 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP PPPP G PP PPP G Sbjct: 310 PPPPQAPPPPPPPPQGLPPGATIANPPRGPPPPMPG 345 Score = 35.5 bits (78), Expect = 2.4 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXX--GGPPPXPPPXXXGG--PXFXPXXRXVIPPS 53 PPPP PPPP G GG P PPP G F P + PPS Sbjct: 339 PPPPMPGTLPPPPPPMGNGPRPMPPGGALPVPPPPVGSGTMANFTPGTQMARPPS 393 >UniRef50_Q9W0H1 Cluster: CG9184-PA, isoform A; n=5; Sophophora|Rep: CG9184-PA, isoform A - Drosophila melanogaster (Fruit fly) Length = 242 Score = 37.1 bits (82), Expect = 0.79 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP GPPP PPP GP + P Sbjct: 117 PPPPQRPWGPPPPP----------GPPPPGPPPPP-GPYYNP 147 >UniRef50_Q7PUR9 Cluster: ENSANGP00000008445; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000008445 - Anopheles gambiae str. PEST Length = 2086 Score = 37.1 bits (82), Expect = 0.79 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGG--GXGGPPPXXPPPXXGGP 93 P PP G PPPP G G GGP P PPP G P Sbjct: 210 PSPPVP--GPPPPPGTQSAQGPPGSGGPQPPHPPPPGGYP 247 >UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyostelium discoideum AX4|Rep: Slob family protein kinase - Dictyostelium discoideum AX4 Length = 574 Score = 37.1 bits (82), Expect = 0.79 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP PPPP G PPP PPP G P P PP+ G Sbjct: 497 PPPP------PPPPPPSKSSGPP--PPPPPPPKSSGPPPPPPPKSSPPPPADG 541 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP--XXPPPXXGG 96 PPPP G PPPP G PPP PPP G Sbjct: 503 PPPPSKSSGPPPPPPPPPKSSGPPPPPPPKSSPPPPADG 541 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 200 PPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PP PPPP G PPP PPP GP P Sbjct: 492 PPISSPPPPPPPPPPSKSSGP--PPPPPPPPKSSGPPPPP 529 >UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: Formin B - Trypanosoma cruzi strain CL Brener Length = 968 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP G PPP PPP Sbjct: 476 PPPPGKNAPPPPPPPPPPPPHGKKAPPPPPPPP 508 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGG---GXXGGPPPXPPPXXXG 98 PPPP APPPP G PPP PPP G Sbjct: 474 PPPPPPGKNAPPPPPPPPPPPPHGKKAPPPPPPPPKIIG 512 >UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 37.1 bits (82), Expect = 0.79 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Frame = -1 Query: 205 PPPPXXXXG----APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP PPPP GG PP PPP P P + V PP RG Sbjct: 257 PPPPSKQQQQQQVVPPPPAP----SAKGGAPPPPPPPPPPPPPPPPPPKGVPPPPRG 309 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP GPPP PPP Sbjct: 285 PPPPPPPPPPPPPPPPKGVPPPPRGPPPPPPP 316 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP PPPP G PPP PP G Sbjct: 286 PPPPPPPPPPPPPPPKGVPPPPRGPPPPPPPKAPISG 322 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = -3 Query: 206 PPPPXXXXGX----PPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP GG PPP PPP P Sbjct: 257 PPPPSKQQQQQQVVPPPPAPSAKGGAPPPPPPPPPPPPPPPP 298 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXG-GGGXGGPPPXXPP--PXXGGP 93 PPPP PPPP G GPPP PP P G P Sbjct: 284 PPPPPPPPPPPPPPPPPKGVPPPPRGPPPPPPPKAPISGQP 324 >UniRef50_Q0U760 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 580 Score = 37.1 bits (82), Expect = 0.79 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXG----GPPPXXPPPXXGGPXFXP 81 PPPP PPPP G G GPPP PP GG P Sbjct: 514 PPPPPGTPPPPPPPGSPPDTPGPGPPHPGPPPGMRPPSAGGNGSMP 559 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP GP P P P G Sbjct: 511 PPPPPPPPGTPPPPPPPGSPPDTPGPGPPHPGPPPG 546 Score = 34.7 bits (76), Expect = 4.2 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG-GPXFXPXXRXVIPPSRG 47 PPPP G PPPP PPP PP G GP + PPS G Sbjct: 511 PPPPPPPPGTPPPP-----------PPPGSPPDTPGPGPPHPGPPPGMRPPSAG 553 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP GPP PPP P Sbjct: 513 PPPPPPGTPPPPPPPGSPPDTPGPGPPHPGPPPGMRPP 550 >UniRef50_A3GHI1 Cluster: Predicted protein; n=1; Pichia stipitis|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 1103 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP G PPP G PPP PPP Sbjct: 307 PPPPHQGMGYGPPPWARRPWDAWGPPPPGPPPP 339 >UniRef50_A2QUG1 Cluster: Similarity to the N. crassa protein. Additionally; n=5; Trichocomaceae|Rep: Similarity to the N. crassa protein. Additionally - Aspergillus niger Length = 578 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP G PPP PP G F P Sbjct: 495 PPPPNYQGTWPPPPPPAMNLGAAHPPPPPPPHAAHQGSHFPP 536 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP G PPP P G F P Sbjct: 495 PPPPNYQGTWPPPPPPAMNLGAAHPPPPPPPHAAHQGSHFPP 536 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP G PPP PPP PPP Sbjct: 494 PPPPPNYQGTWPPPPPPAMNLGAAHPPPPPPP 525 >UniRef50_Q63627 Cluster: Splicing factor, arginine/serine-rich 15; n=7; Murinae|Rep: Splicing factor, arginine/serine-rich 15 - Rattus norvegicus (Rat) Length = 1048 Score = 37.1 bits (82), Expect = 0.79 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PP G PPP G G G PPP PPP GP F P GP Sbjct: 611 PPAFTPPLGIPPP------GFGPGVPPPPPPPPPFWGPGFNPMHLPPGFLPPGP 658 >UniRef50_Q07048 Cluster: RNA-directed RNA polymerase; n=1; Saccharomyces 23S RNA narnavirus|Rep: RNA-directed RNA polymerase - Saccharomyces 23S RNA narnavirus (ScNV-23S) Length = 941 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -3 Query: 182 GXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 G PPPP GGGG GPP PPP G Sbjct: 882 GLPPPPPPPLGGGGMAGPP---PPPFMG 906 >UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - Mus musculus (Mouse) Length = 1567 Score = 37.1 bits (82), Expect = 0.79 Identities = 24/75 (32%), Positives = 24/75 (32%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G G PPPP PPPP A PPP G Sbjct: 1006 GVGIPPPPPLPGVGIPPPPPLPGMGIPPPPPLPGSGIPPPPALPGVAIPPPPPLPG---M 1062 Query: 136 GGPPPXPPPXXXGGP 92 G PPP PPP G P Sbjct: 1063 GVPPPAPPPPGAGIP 1077 Score = 35.5 bits (78), Expect = 2.4 Identities = 23/65 (35%), Positives = 24/65 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP G PPPP PPP P P P P IPP L + P Sbjct: 1033 PPPPLPGSGIPPPPALPG----VAIPPPPPLPGMGVPPPAPPPPGAGIPPPPLLPGSGPP 1088 Query: 25 SXSXV 11 S V Sbjct: 1089 HSSQV 1093 Score = 35.1 bits (77), Expect = 3.2 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPP G PPPP G G PP PP G P P IPP Sbjct: 899 PPPLPGLGVPPPPPAPPLPGM--GIPPPPPLPGMGIPPPPPLPGMGIPP 945 Score = 34.3 bits (75), Expect = 5.6 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G PPPP G G PP PP G P P IPP Sbjct: 923 PPPPLPGMGIPPPPPL-PGMGI----PPPPPLPGVGIPPPPPLPGVGIPP 967 Score = 34.3 bits (75), Expect = 5.6 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G PPPP G G PP PP G P P IPP Sbjct: 945 PPPPLPGVGIPPPPPL-PGVGI----PPPPPLPGVGIPPPPPLPGVGIPP 989 Score = 34.3 bits (75), Expect = 5.6 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G PPPP G G PP PP G P P IPP Sbjct: 978 PPPPLPGVGIPPPPPL-PGVGI----PPPPPLPGVGIPPPPPLPGVGIPP 1022 Score = 33.9 bits (74), Expect = 7.4 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP G PPPP G PPP P G P P IPP L A P Sbjct: 1000 PPPPLPGVGIPPPPPLPGVG--IPPPPPLP---GMGIPPPPPLPGSGIPPPPALPGVAIP 1054 >UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L splicing variant; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to FHOS2L splicing variant - Strongylocentrotus purpuratus Length = 1146 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP G PP PPP GP P Sbjct: 584 PPPPLPGLGIPPPPPIP-------GAPPPPPPPAMKGPGAPP 618 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PPPP G PP PPP GP P Sbjct: 584 PPPPLPGLGIPPPPPIP-------GAPPPPPPPAMKGPGAPP 618 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXP 116 PPP GAPPPP G G PPP P Sbjct: 594 PPPPPIPGAPPPPPPPAMKG-PGAPPPPP 621 >UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: Enabled homolog - Rattus norvegicus (Rat) Length = 526 Score = 36.7 bits (81), Expect = 1.0 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP--PPXXGGPXFXPXXXEXNSPXXG 48 PPPP G PPPP PPP P PP F E N P G Sbjct: 293 PPPPLPSAGPPPPPPPPPPLPNQVPPPPPPPPAPPLPASGIFSGSMSEDNRPLTG 347 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP PPP PPP G P Sbjct: 1422 PPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGTGLFP 1463 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP G P Sbjct: 1422 PPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGTGLFP 1463 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP PPP PPP Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP PPP PPP Sbjct: 1421 PPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPP 1452 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP PPP PPP Sbjct: 1421 PPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 >UniRef50_A1SEF2 Cluster: Putative uncharacterized protein; n=1; Nocardioides sp. JS614|Rep: Putative uncharacterized protein - Nocardioides sp. (strain BAA-499 / JS614) Length = 282 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPP G PPPP GG PPP P P GG Sbjct: 18 PPPSGDGYGGPPPPT---GGYGENPPPPPPAPSYGGG 51 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP------XXPPPXXGGPXF 87 PPPP PPPP G G GGPPP PPP P + Sbjct: 6 PPPPDQA---PPPPLPPPSGDGYGGPPPPTGGYGENPPPPPPAPSY 48 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPP G PPPP GG G PPP P GG Sbjct: 18 PPPSGDGYGGPPPPT---GGYGENPPPPPPAPSYGGG 51 >UniRef50_A0R1W2 Cluster: Putative uncharacterized protein; n=1; Mycobacterium smegmatis str. MC2 155|Rep: Putative uncharacterized protein - Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Length = 194 Score = 36.7 bits (81), Expect = 1.0 Identities = 21/55 (38%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = -1 Query: 181 GAPPPPXXXXGG--GXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXPS 23 GAPPPP G GPPP PPP P P R PP R + P+ Sbjct: 5 GAPPPPGAPRPAAPGPRPGPPPGPPPGPLRPPAAPP--RHSAPPPRATRPAPRPN 57 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTP 279 Score = 36.7 bits (81), Expect = 1.0 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAY 36 PPPP PPPP PPP PPP P P + SP Y Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTPNNFPY 284 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP PPPP PPP PPP P P PP +G Sbjct: 225 PPPPPPPPPPPPPPPPP---SPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKG 274 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P GP Sbjct: 225 PPPPPPPPPPPPPPPPP---SPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGP 275 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP PPP P P GP P Sbjct: 238 PPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTP 279 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 P PP PPPP PPP PPP P P PP Sbjct: 223 PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPP 272 >UniRef50_Q8MQE6 Cluster: Wasp (Actin cytoskeleton modulator) homolog protein 1, isoform b; n=3; Caenorhabditis|Rep: Wasp (Actin cytoskeleton modulator) homolog protein 1, isoform b - Caenorhabditis elegans Length = 781 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP PPPP G G PPP PPP G Sbjct: 630 PPPP------PPPPPMGLPAVGAGAPPPPPPPPPSG 659 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP PPP G PPP PPP GGP Sbjct: 630 PPPPPP----PPPMGLPAVGAGAPPPPPPPPPSGAGGP 663 >UniRef50_Q7PNQ0 Cluster: ENSANGP00000005715; n=2; Culicidae|Rep: ENSANGP00000005715 - Anopheles gambiae str. PEST Length = 859 Score = 36.7 bits (81), Expect = 1.0 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXG--GPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP G PP GG G PPP PPP P P + P G Y Sbjct: 171 PPPPSCPAGGVPPYCCTNGGSGPNCYVPPPPTPPPTRPPP--PPPTRPPSCPAGGVPPYC 228 Query: 32 XT 27 T Sbjct: 229 CT 230 Score = 33.9 bits (74), Expect = 7.4 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXG---GPPPXXPPP 108 PPPP G PP GG G PPP PPP Sbjct: 43 PPPPSCPAGGVPPYCCTNGGSGPNCYVPPPPTRPPP 78 >UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG05727; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG05727 - Caenorhabditis briggsae Length = 288 Score = 36.7 bits (81), Expect = 1.0 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 7/49 (14%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXX-------GGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PPPP PPP PPP GGP P Sbjct: 151 PPPPPRGTGTPPPPPTGVPEELNEANHASRRPPPPPPPPKGTGGPPPPP 199 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 6/48 (12%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXX------GGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G P PP G PPP PPP G P P Sbjct: 84 PPPPPRGTGTPSPPPSEEPRDLVEGNASRRPPPPPPPPKATGSPPPPP 131 Score = 34.7 bits (76), Expect = 4.2 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Frame = -1 Query: 205 PPPPXXXXGAPPP--------PXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G+PPP P GG PPP PPP G P P Sbjct: 117 PPPPPKATGSPPPPPPPPSDEPQEVVAGGASRRPPP-PPPRGTGTPPPPP 165 >UniRef50_Q5TJB8 Cluster: Diaphanous-related formin dDia2; n=2; Dictyostelium discoideum|Rep: Diaphanous-related formin dDia2 - Dictyostelium discoideum (Slime mold) Length = 1087 Score = 36.7 bits (81), Expect = 1.0 Identities = 19/43 (44%), Positives = 22/43 (51%) Frame = -1 Query: 181 GAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 G+PPPP G G PPP PPP GG P + +I PS Sbjct: 592 GSPPPPPPPPMSGGGGPPPPPPPP---GGKSNKP-AKPIIKPS 630 Score = 33.9 bits (74), Expect = 7.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 182 GXPPPPXXXXGGGGXGGPPPXXPP 111 G PPPP GG G PPP PP Sbjct: 592 GSPPPPPPPPMSGGGGPPPPPPPP 615 >UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic proline-rich protein; n=1; Yarrowia lipolytica|Rep: Similar to tr|Q95JC9 Sus scrofa Basic proline-rich protein - Yarrowia lipolytica (Candida lipolytica) Length = 659 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGG---XGGPPPXXPP 111 PPPP G PPPP GG G GG P PP Sbjct: 8 PPPPPPGFGGPPPPPPPGGGFGALSSGGAPKAGPP 42 >UniRef50_Q6C3N1 Cluster: Yarrowia lipolytica chromosome E of strain CLIB 122 of Yarrowia lipolytica; n=1; Yarrowia lipolytica|Rep: Yarrowia lipolytica chromosome E of strain CLIB 122 of Yarrowia lipolytica - Yarrowia lipolytica (Candida lipolytica) Length = 582 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 PPP G P G GG GGPPP P G P F Sbjct: 521 PPPNGSMGPGGPGGPPGGPGGPGGPPPHMHGPPPGFPPF 559 >UniRef50_Q5AVQ4 Cluster: Putative uncharacterized protein; n=1; Emericella nidulans|Rep: Putative uncharacterized protein - Emericella nidulans (Aspergillus nidulans) Length = 798 Score = 36.7 bits (81), Expect = 1.0 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXG-GPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAY 36 P P G PPPP G G G GP P PP GP + P P GP Y Sbjct: 712 PMPPPSRGRPPPPGYPGPGRGRGRGPRPPGPP----GP-YGPGPGRSGRPGPGPAPY 763 >UniRef50_A6QTR5 Cluster: Adenylyl cyclase-associated protein; n=1; Ajellomyces capsulatus NAm1|Rep: Adenylyl cyclase-associated protein - Ajellomyces capsulatus NAm1 Length = 500 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G GGPPP PPP G Sbjct: 230 PPPPPPPPPTAGAGGPPPPPPPPAGG 255 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP PPPP G G G PPP PPP P Sbjct: 229 PPPP------PPPPPPTAGAG--GPPPPPPPPAGGAAP 258 >UniRef50_Q9NSV4 Cluster: Protein diaphanous homolog 3; n=66; Deuterostomia|Rep: Protein diaphanous homolog 3 - Homo sapiens (Human) Length = 1193 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = -1 Query: 205 PPPPXXXXGA-----PPPPXXXXGGGXXGGPPPXPPPXXXG 98 P PP G PPPP GGG PPP PPP G Sbjct: 561 PLPPSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLPG 601 >UniRef50_P19835 Cluster: Bile salt-activated lipase precursor; n=61; Euteleostomi|Rep: Bile salt-activated lipase precursor - Homo sapiens (Human) Length = 742 Score = 36.7 bits (81), Expect = 1.0 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXX------GGPPPXPPPXXXGGPXFXPXXRXVIPP 56 P PP GAPP P G GPPP PP G P P PP Sbjct: 636 PVPPTGDSGAPPVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPP 691 Score = 33.5 bits (73), Expect = 9.8 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXX------GGPPPXPPPXXXGGPXFXPXXRXVIPP 56 P PP GAPP P G G PP PP G P P PP Sbjct: 581 PVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPP 636 Score = 33.5 bits (73), Expect = 9.8 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXX------GGPPPXPPPXXXGGPXFXPXXRXVIPP 56 P PP GAPP P G G PP PP G P P PP Sbjct: 592 PVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPP 647 Score = 33.5 bits (73), Expect = 9.8 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXX------GGPPPXPPPXXXGGPXFXPXXRXVIPP 56 P PP GAPP P G G PP PP G P P PP Sbjct: 603 PVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPP 658 >UniRef50_Q4T2J8 Cluster: Chromosome undetermined SCAF10255, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF10255, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1165 Score = 36.3 bits (80), Expect = 1.4 Identities = 21/66 (31%), Positives = 26/66 (39%), Gaps = 6/66 (9%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVI------PPSRGL 44 PPPP PPPP G GG PPP G P + ++ PP RG Sbjct: 854 PPPPDEFPPYPPPPYPSCGRSEQGGDVVDPPPPEVRG-QVPPERKSILRRCGSEPPDRGA 912 Query: 43 KLTAXP 26 ++ P Sbjct: 913 RVRFNP 918 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP PPPP G GG PPP G Sbjct: 854 PPPPDEFPPYPPPPYPSCGRSEQGGDVVDPPPPEVRG 890 >UniRef50_Q1LVB7 Cluster: Novel protein; n=5; Danio rerio|Rep: Novel protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 198 Score = 36.3 bits (80), Expect = 1.4 Identities = 20/52 (38%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG--GPXFXPXXRXVIPP 56 PPPP PPPP G PPP PPP G P R ++PP Sbjct: 112 PPPPPMHMRGPPPPHMH----RHGPPPPPPPPGHPAFRGRPPHPRGRGMMPP 159 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 PPPP PPPP GPPP PPP G P F Sbjct: 112 PPPPPMHMRGPPPPHMH-----RHGPPP--PPPPPGHPAF 144 >UniRef50_A1BM55 Cluster: Capsid protein-like protein; n=2; Ovine herpesvirus 2|Rep: Capsid protein-like protein - Ovine herpesvirus 2 Length = 211 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPP----PXXXXGGGGAPXXXXGGGG 206 PP G G GGGPP PP P GGG GGG Sbjct: 99 PPHPSGAGSGGGPPNAPPLPDKPDPQQGGGANNQSQGSGGG 139 >UniRef50_Q9L252 Cluster: Putative uncharacterized protein SCO2669; n=1; Streptomyces coelicolor|Rep: Putative uncharacterized protein SCO2669 - Streptomyces coelicolor Length = 604 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPP G GG GG P P G P P Sbjct: 33 PPPPGGGYGFPPPAGP-GGPGGPGGGPGGGPGGPGGEPQLCP 73 Score = 35.1 bits (77), Expect = 3.2 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP-XXXEXNSPXXG 48 PPPP PPPP G GG GG P P GP P E N P G Sbjct: 360 PPPPGPV---PPPPGGAGGPGGPGG-PGGAPQGYQAGPPAPPAFPQEANRPQQG 409 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXR 71 PPPP G PPP G G GG P P G P P R Sbjct: 33 PPPPGGGYGFPPPAGP-GGPGGPGGGPGGGPGGPGGEPQLCPQCR 76 Score = 33.9 bits (74), Expect = 7.4 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP GGG G PPP P GGP P Sbjct: 28 PPPPPPPPPGGGYGFPPPAG-PGGPGGPGGGP 58 >UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1; Pseudomonas entomophila L48|Rep: Insecticidal toxin, SepC/Tcc class - Pseudomonas entomophila (strain L48) Length = 990 Score = 36.3 bits (80), Expect = 1.4 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PPPP PPPP G G PPP PPP G P P P GP A Sbjct: 703 PPPPPSGMRLPPPPPPP----GMGTPPP--PPPGMGLP---PPPPGLRPPPPGPGA 749 >UniRef50_Q0B341 Cluster: Putative uncharacterized protein; n=4; Burkholderia cepacia complex|Rep: Putative uncharacterized protein - Burkholderia cepacia (strain ATCC 53795 / AMMD) Length = 272 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +3 Query: 114 GGXGGGPPXXP-PPXXXXGGGGAPXXXXGGGG 206 GG GGG P PP GGG AP GGGG Sbjct: 60 GGIGGGTPSYSAPPAYAGGGGAAPAGVSGGGG 91 >UniRef50_A7IPA8 Cluster: Putative uncharacterized protein precursor; n=1; Xanthobacter autotrophicus Py2|Rep: Putative uncharacterized protein precursor - Xanthobacter sp. (strain Py2) Length = 544 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG-GGXGGPPPXXPPPXXGGP 93 PPPP G P P GG GG GGP P GGP Sbjct: 293 PPPPPPPGGWPGGPGGWPGGPGGPGGPGGPGGPGGPGGP 331 >UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein; n=1; Mycobacterium gilvum PYR-GCK|Rep: Integral membrane protein-like protein - Mycobacterium gilvum PYR-GCK Length = 335 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXX---GGGGXGGPPPXXPPPXXGGP 93 PPP G PPPP G G G PPP P GGP Sbjct: 65 PPPPGQGGYPPPPGGYGMPPAGFGGGYPPPGQGYPPVGGP 104 Score = 34.3 bits (75), Expect = 5.6 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAY 36 PPPP G PPP GG P PPP G P P GP Y Sbjct: 11 PPPPQ---GGYPPPPPSEGGYPPPPPEGGYPPPPPAGGYQQPPPGGAYPPPPGPGGY 64 >UniRef50_Q9SXE7 Cluster: T3P18.6; n=2; core eudicotyledons|Rep: T3P18.6 - Arabidopsis thaliana (Mouse-ear cress) Length = 297 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GGG GGG PPP GGG P GGG Sbjct: 40 PPQHGGG--GGGGSKPPPHHGGKGGGKPPPHGGKGGG 74 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPP G PP GGGG PP PPP Sbjct: 65 PPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPP 96 >UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP3 protein - Volvox carteri f. nagariensis Length = 687 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 602 PPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPP 643 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 612 PPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPP 653 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 597 PPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPP 638 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP PPP PPP P Sbjct: 607 PPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPP 644 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSR 50 PPPP +PPPP PPP PP P P PP R Sbjct: 612 PPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSP--PPPR 661 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 627 PPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPP 668 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP +PPPP PPP PP P P Sbjct: 602 PPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPP 643 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP PPPP PPP PP P P R P S Sbjct: 627 PPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPPTRRSPPPTS 677 Score = 33.9 bits (74), Expect = 7.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP PPPP PPP PPP P P N P P Sbjct: 593 PPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPP---PSPPPPNPPPPSP 642 >UniRef50_Q7F0U2 Cluster: OJ1116_C07.3 protein; n=4; Oryza sativa|Rep: OJ1116_C07.3 protein - Oryza sativa subsp. japonica (Rice) Length = 195 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +1 Query: 97 PPXXGGGXX---GGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GGG GGG PPP GGGG GGGG Sbjct: 95 PPYSGGGGGSSTGGGGIYYPPPTGGGGGGGGGWQQGGGGG 134 Score = 33.9 bits (74), Expect = 7.4 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -3 Query: 206 PPPPXXXXGX--PPPPXXXXGGGGXGGPP----PXXPPPXXGG 96 PPPP PPPP GGGG GG PPP GG Sbjct: 58 PPPPVVTPTPQCPPPPSYPSGGGGGGGGGTVMYTSPPPPYSGG 100 >UniRef50_Q6H899 Cluster: Nuclear protein ZAP-like; n=6; Magnoliophyta|Rep: Nuclear protein ZAP-like - Oryza sativa subsp. japonica (Rice) Length = 753 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -3 Query: 206 PPPPXXXXGXP-PPPXXXXGGGGXGGPPP 123 PPPP G P PPP GGG G PPP Sbjct: 137 PPPPGMLHGEPYPPPDRFGYGGGRGYPPP 165 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -1 Query: 205 PPPPXXXXGAP-PPPXXXXGGGXXGGPPP 122 PPPP G P PPP GG G PPP Sbjct: 137 PPPPGMLHGEPYPPPDRFGYGGGRGYPPP 165 >UniRef50_Q6AVV7 Cluster: Expressed protein; n=3; Oryza sativa|Rep: Expressed protein - Oryza sativa subsp. japonica (Rice) Length = 229 Score = 36.3 bits (80), Expect = 1.4 Identities = 22/66 (33%), Positives = 24/66 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP P P P PPP G P F P R P RG L A Sbjct: 54 PPPPPPPPPLPQPQHHHDAVSTDESRTPPPPPPPMGAPGFGP-FRWSPRPLRGAPLAAWD 112 Query: 25 SXSXVQ 8 + S V+ Sbjct: 113 AASPVR 118 >UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Extensin - Volvox carteri Length = 464 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP +PPPP PPP PPP Sbjct: 312 PPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPP 343 Score = 36.3 bits (80), Expect = 1.4 Identities = 25/94 (26%), Positives = 29/94 (30%), Gaps = 5/94 (5%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXX---GGGXXGG 131 PPPP + PPPP PP P GG G Sbjct: 366 PPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGT 425 Query: 130 PPPXPPPXXXGGP--XFXPXXRXVIPPSRGLKLT 35 PP PPP P + P + + PP K T Sbjct: 426 RPPPPPPEDDAPPPDYYFPPPQDMSPPPPKKKAT 459 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPP PPP PPP P P + P Sbjct: 311 PPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPP 360 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPP PPP PP P P PP Sbjct: 311 PPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPP 360 >UniRef50_O23691 Cluster: Putative uncharacterized protein T19D16.24; n=2; Arabidopsis thaliana|Rep: Putative uncharacterized protein T19D16.24 - Arabidopsis thaliana (Mouse-ear cress) Length = 554 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 P PP PPPP G PP PPP GG Sbjct: 250 PLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGARGG 286 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPP PPPP G G PPP PP GG Sbjct: 252 PPPGTAALPPPPPLPMAAGKGVAAPPPP-PPGARGG 286 >UniRef50_A7QG78 Cluster: Chromosome undetermined scaffold_91, whole genome shotgun sequence; n=2; Eukaryota|Rep: Chromosome undetermined scaffold_91, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 79 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G GPP GG GG P P G GG P GGGG Sbjct: 30 GGPRGPPGEFGGDKGGAPADFQP--SFRGSGGRPGFGRGGGG 69 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G GPP GG GG P P G GG P GGGG Sbjct: 30 GGPRGPPGEFGGDKGGAPADFQP--SFRGSGGRPGFGRGGGG 69 >UniRef50_A5BAX2 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 131 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP G PPP PPP Sbjct: 28 PPPPPDHPLPPPPPKCSSTGAPPLAPPPPVPPP 60 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP PPP G PPP PPP P Sbjct: 29 PPPPDHPLPPPPPKCSSTGAPPLAPPPPVPPPPPPPSP 66 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPP G PPP PPP P Sbjct: 29 PPPPDHPLPPPPPKCSSTGAPPLAPPPPVPPPPPPPSP 66 >UniRef50_A2XET4 Cluster: Putative uncharacterized protein; n=2; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 352 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PP GG PPP PPP G P P Sbjct: 282 PPPPNAPMGMPPRIPPPPVGGTQ--PPPPPPPLANGPPRSIP 321 Score = 33.9 bits (74), Expect = 7.4 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 2/91 (2%) Frame = -1 Query: 313 GGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXG 134 G G PP P PPPP PPPP G Sbjct: 260 GSGGPPRPPAPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLAN----G 315 Query: 133 GPPPXPPPXXXGG--PXFXPXXRXVIPPSRG 47 P PPP GG F P PP +G Sbjct: 316 PPRSIPPPPMTGGAMANFTPGAPPPRPPMQG 346 >UniRef50_Q58MX6 Cluster: Phage tail fiber-like protein; n=1; Cyanophage P-SSM2|Rep: Phage tail fiber-like protein - Cyanophage P-SSM2 Length = 559 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 GPP G G GPP PP GG G P GG Sbjct: 337 GPPGADGDDGGSGPPGPPGSDGSDGGSGPPGPPGPTGG 374 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 GPP G G GPP PP P GG G P GG G Sbjct: 352 GPPGSDGSDGGSGPPGPPGP---TGGDGPP--GPGGTG 384 >UniRef50_Q4R8N9 Cluster: Testis cDNA clone: QtsA-11950, similar to human diaphanous homolog 1 (Drosophila) (DIAPH1),; n=4; Eutheria|Rep: Testis cDNA clone: QtsA-11950, similar to human diaphanous homolog 1 (Drosophila) (DIAPH1), - Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey) Length = 504 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = -3 Query: 206 PPPPXXXXGXP--PPPXXXXGGGGXGGPPP---XXPPPXXG 99 PPPP G P PPP GG G PPP PPP G Sbjct: 2 PPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFG 42 Score = 34.3 bits (75), Expect = 5.6 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP GG G PPP P P G P P PP G +A P Sbjct: 2 PPPPPPLPGG--PGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGASAAP 49 Score = 33.9 bits (74), Expect = 7.4 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = -1 Query: 205 PPPPXXXXGAP--PPPXXXXGGGXXGGPPP---XPPPXXXG 98 PPPP G P PPP GG PPP PPP G Sbjct: 2 PPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFG 42 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAY 36 PPPP GG G PP PPP GGP P P P + Sbjct: 2 PPPPPPLPGGPGI--PP---PPPFPGGPGIPPPPPGMGMPPPPPFGF 43 >UniRef50_Q54CQ8 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 910 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPPP G G PPP PPP P Sbjct: 722 PPPPMMSSGPPPPP-----GSSFGAPPP--PPPGGAFP 752 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP PPPP G G PPP PP Sbjct: 721 PPPPPMMSSGPPPPP----GSSFGAPPPPPP 747 >UniRef50_A7TC21 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 206 Score = 36.3 bits (80), Expect = 1.4 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXP---PPXXXGGPXFXPXXRXVIPPSRG 47 PPP G PP P G GGPP P PP G P + PP RG Sbjct: 84 PPPPQHTG-PPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRG 137 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXX-PPPXXGGP 93 PPPP G PPPP PPP PPP GP Sbjct: 115 PPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGP 153 Score = 34.3 bits (75), Expect = 5.6 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPP P PP GGG PP PPP G P P G Sbjct: 85 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRG 137 >UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; Suberites domuncula|Rep: Wiskott-Aldrich syndrome protein - Suberites domuncula (Sponge) Length = 410 Score = 36.3 bits (80), Expect = 1.4 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 205 PPPPXXXXG--APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP G PPPP GG PP PPP P P PP Sbjct: 285 PPPPRGGPGRGGPPPPSNSRGGSAPA--PPPPPPVGVPAPPPPPPVGGTGPP 334 Score = 35.9 bits (79), Expect = 1.8 Identities = 20/56 (35%), Positives = 22/56 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PPPP PPPP GG P PP GGP P + +S P A Sbjct: 312 PPPPPVGVPAPPPPPP------VGGTGPPKPPSAAGGPPPPPSRDKPSSSLPAPPA 361 >UniRef50_A0CJV0 Cluster: Chromosome undetermined scaffold_2, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_2, whole genome shotgun sequence - Paramecium tetraurelia Length = 362 Score = 36.3 bits (80), Expect = 1.4 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPP-----XPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP G PPP G PPP PPP G + P PP G Sbjct: 211 PPPPPMQQGYVPPPPPPMQQGYVPPPPPMQQGYVPPPPPPGQQPYTPYPSTYTPPYTG 268 Score = 33.5 bits (73), Expect = 9.8 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-----XXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP G PPP G PPP PPP G + P P G Sbjct: 211 PPPPPMQQGYVPPPPPPMQQGYVPPPPPMQQGYVPPPPPPGQQPYTPYPSTYTPPYTG 268 >UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|Rep: Predicted protein - Neurospora crassa Length = 452 Score = 36.3 bits (80), Expect = 1.4 Identities = 24/57 (42%), Positives = 25/57 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLT 35 PPPP PPPP G GGPPP PPP P P P+RG LT Sbjct: 2 PPPP------PPPPPPPPG---MGGPPPPPPPPPGALPGRPPAGL----PNRGALLT 45 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G GGPPP PPP P P Sbjct: 3 PPPPPPPPPPPGMGGPPPPPPPPPGALPGRPP 34 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP 114 PPPP G PPPP G G PP P Sbjct: 8 PPPPPPGMGGPPPPPPPPPGALPGRPPAGLP 38 >UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 592 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP GG PPP PPP Sbjct: 210 PPPP------PPPPSNPPGGNLRAPPPPPPPP 235 Score = 33.5 bits (73), Expect = 9.8 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP GG PPP PPP P P P P Sbjct: 210 PPPP------PPPPSNPPGGNLRAPPPP--PPPPAAPPRPVPEAAPAPPPPPAP 255 >UniRef50_Q0U8T6 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 285 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP APPPP G PPP GG Sbjct: 208 PPPPPAGCEAPPPPPPAAGAAAAAAADAVPPPPPAGG 244 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP PPPP G PPP GG Sbjct: 208 PPPPPAGCEAPPPPPPAAGAAAAAAADAVPPPPPAGG 244 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP G PPP PPP G Sbjct: 197 PPPPAAESGLPPPPPP----AGCEAPPP--PPPAAG 226 >UniRef50_Q9Y2W2 Cluster: WW domain-binding protein 11; n=42; Euteleostomi|Rep: WW domain-binding protein 11 - Homo sapiens (Human) Length = 641 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 203 PPPXXXXGXPP-PPXXXXGGGGXGGPPPXXPPPXXGG 96 PPP G PP PP G GPPP PPP G Sbjct: 462 PPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPG 498 Score = 35.1 bits (77), Expect = 3.2 Identities = 20/53 (37%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = -1 Query: 202 PPPXXXXGAPP--PPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXR--XVIPP 56 PPP G PP PP G G PP PPP G P P ++PP Sbjct: 462 PPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPP 514 >UniRef50_Q15428 Cluster: Splicing factor 3A subunit 2; n=69; Eukaryota|Rep: Splicing factor 3A subunit 2 - Homo sapiens (Human) Length = 464 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP PP P GPP PPP P P V PP+ G+ Sbjct: 252 PPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPP----APGVHPPAPVVHPPASGV 301 >UniRef50_Q9H461 Cluster: Frizzled-8 precursor; n=10; Theria|Rep: Frizzled-8 precursor - Homo sapiens (Human) Length = 694 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGG 201 PP GGG GGG PP GGGG GG Sbjct: 190 PPHRGGGRGGGGGDAAAPPARGGGGGGKARPPGGG 224 >UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=2; Mus musculus|Rep: FH1/FH2 domain-containing protein 1 - Mus musculus (Mouse) Length = 1197 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = -1 Query: 205 PPPPXXXXGA----PPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP G+ PPPP G PPP PPP G Sbjct: 591 PPPPPPITGSCPPPPPPPLPPPATGSCPPPPPPPPPPIIG 630 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = -3 Query: 206 PPPPXXXXGX----PPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP G PPP PPP G Sbjct: 591 PPPPPPITGSCPPPPPPPLPPPATGSCPPPPPPPPPPIIG 630 >UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morphogenesis 1; n=37; Amniota|Rep: Disheveled-associated activator of morphogenesis 1 - Homo sapiens (Human) Length = 1078 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP GG PPP PPP Sbjct: 553 PPPPLPGGMLPPPPPPLPPGGPP--PPPGPPP 582 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP GG PPP PP P P ++PP Sbjct: 550 PPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPP 589 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,279,532 Number of Sequences: 1657284 Number of extensions: 15238091 Number of successful extensions: 302240 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 33652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 206287 length of database: 575,637,011 effective HSP length: 102 effective length of database: 406,594,043 effective search space used: 106121045223 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -