BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L01 (1093 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1136 + 24218601-24218734,24218769-24219906 43 4e-04 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 42 6e-04 02_05_0686 - 30900748-30902167,30903442-30904742 42 6e-04 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 42 9e-04 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 42 9e-04 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 40 0.003 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 38 0.011 02_04_0382 - 22501041-22501279,22501717-22501810 38 0.011 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 38 0.011 01_07_0082 - 40965947-40967023 38 0.014 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 37 0.024 10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081,704... 36 0.043 03_05_0732 - 27232299-27232535,27232717-27232746,27233094-272331... 36 0.043 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 36 0.043 02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787,643... 36 0.043 01_03_0005 + 11568545-11569119,11569179-11569191 36 0.043 09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052,174... 36 0.075 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 35 0.099 06_02_0257 - 13533689-13533714,13533799-13533925,13534013-135341... 35 0.13 01_06_1377 + 36764461-36765339 35 0.13 01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 35 0.13 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 34 0.17 07_03_1691 - 28726307-28726323,28726588-28726953,28727483-287275... 34 0.17 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 34 0.17 07_01_0080 + 587674-588510 34 0.17 09_02_0543 + 10427321-10428315,10428440-10429154 34 0.23 09_02_0495 + 9880714-9881196 34 0.23 07_03_1382 - 26170563-26170631,26171151-26171843 34 0.23 07_03_0866 - 22134215-22135351 34 0.23 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 34 0.23 03_01_0515 - 3864796-3865425 34 0.23 06_03_0927 + 26015956-26018230,26018323-26018471,26018550-260186... 33 0.30 05_02_0161 + 7199005-7199505,7200118-7200378,7201532-7201621 33 0.30 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 33 0.30 01_06_1792 - 39912714-39913559 33 0.30 07_01_0479 + 3606663-3607448 33 0.40 02_05_0002 - 24849189-24849825,24850267-24850328 33 0.40 02_01_0302 - 2021221-2023305 33 0.40 07_03_0329 + 16840051-16840917,16840999-16841342,16841444-168415... 33 0.53 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 33 0.53 08_01_0059 - 394001-394708 32 0.69 01_01_0553 - 4067921-4068180,4068437-4068455,4069101-4070225 32 0.69 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 32 0.69 11_06_0557 - 24955837-24956214,24957225-24957395,24957576-249576... 32 0.92 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 32 0.92 07_01_0974 + 8211602-8212051 32 0.92 06_03_1121 + 27767707-27768065,27768612-27769034,27770013-277701... 32 0.92 03_05_0067 - 20460206-20460703,20461255-20461530 32 0.92 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 32 0.92 01_01_0715 - 5542648-5543219,5543352-5543544 32 0.92 01_01_0070 - 542603-542686,542803-543441 32 0.92 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 31 1.1 09_03_0145 - 12749288-12751510 31 1.2 08_02_1019 - 23657175-23658047 31 1.2 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 31 1.2 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 31 1.2 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 31 1.2 01_06_0146 + 26969011-26969995,26970878-26970930 31 1.2 01_01_0796 + 6190931-6192745 31 1.2 09_04_0616 + 18977421-18977907,18977984-18978245,18978903-18979149 31 1.6 09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415,243... 31 1.6 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 31 1.6 05_07_0102 + 27700395-27700426,27701034-27702087,27703205-27703420 31 1.6 05_01_0142 - 940421-940701,941262-941574 31 1.6 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 31 1.6 02_01_0584 - 4326072-4326094,4326306-4326885 31 1.6 01_05_0513 - 22864657-22867899 31 1.6 01_01_0987 + 7803281-7803910,7803989-7804510 31 1.6 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 31 2.1 08_02_1410 - 26876243-26876497,26877129-26877239,26877240-268773... 31 2.1 07_03_0600 + 19866757-19867218,19867920-19868429 31 2.1 06_03_1274 + 28897491-28897707,28897804-28897935,28898029-288980... 31 2.1 02_02_0307 - 8809724-8811589,8811681-8811762,8812130-8812242,881... 31 2.1 06_03_0729 + 23927656-23927661,23927774-23927923,23928316-239285... 25 2.5 05_05_0175 + 22966151-22967614 26 2.6 11_06_0561 - 24984960-24985205,24985283-24985354,24985906-249859... 30 2.8 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 30 2.8 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 30 2.8 08_02_1329 - 26182762-26183007,26183149-26183249,26183533-261836... 30 2.8 06_03_0082 + 16363742-16364632 30 2.8 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 30 2.8 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 30 2.8 04_03_1022 - 21778315-21779007 30 2.8 04_01_0034 - 401208-402923 30 2.8 02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 30 2.8 02_04_0177 + 20669053-20669055,20669150-20669198,20669680-206699... 30 2.8 09_04_0011 + 13703564-13703766,13704685-13705526,13705628-137057... 25 3.4 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 30 3.7 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 30 3.7 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 30 3.7 07_03_1713 + 28939446-28939574,28939674-28940231,28940338-289404... 30 3.7 04_04_1401 + 33279092-33279286,33280223-33280306,33280459-332805... 30 3.7 04_04_1182 + 31531426-31531702,31533741-31533997,31534672-315348... 30 3.7 04_04_1104 - 30928475-30928501,30929008-30929110,30929287-309293... 30 3.7 04_04_0183 - 23384290-23384783,23385064-23385139,23385291-23385296 30 3.7 04_01_0162 + 1845295-1846317,1846430-1846565,1848436-1848626,184... 30 3.7 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 30 3.7 03_06_0144 - 31969609-31969866,31969961-31970371,31970472-319705... 30 3.7 03_01_0023 + 198414-198968 30 3.7 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 30 3.7 01_05_0490 + 22672241-22674679 30 3.7 01_01_0082 + 625198-625719 30 3.7 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 29 4.9 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 29 4.9 08_02_0864 + 21994286-21994989,21996257-21996958,21997221-219973... 29 4.9 08_02_0602 + 19183549-19184919 29 4.9 08_02_0039 - 11512553-11512822,11512920-11513171,11513784-115139... 29 4.9 06_01_0254 + 1898586-1899617 29 4.9 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 29 4.9 04_03_0977 + 21381857-21383757,21384299-21384458,21384669-213847... 29 4.9 03_05_1081 + 30235677-30236474 29 4.9 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 29 4.9 02_04_0400 - 22608519-22608844,22609044-22609122 29 4.9 02_04_0001 - 18816492-18816741,18816881-18817050,18817244-188173... 29 4.9 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 29 4.9 05_01_0131 + 888247-888771,889092-889154 24 6.2 01_05_0319 - 20871781-20871909,20872001-20872053,20873271-20873598 25 6.3 12_02_1007 - 25248653-25249078,25249956-25250021,25250108-252502... 29 6.5 12_02_0998 + 25126114-25126596,25129213-25129339,25129349-251294... 29 6.5 12_02_0848 + 23636478-23638058 29 6.5 10_08_0521 + 18500105-18500529,18501216-18501284,18501467-185015... 29 6.5 10_08_0451 + 18033065-18033253,18033746-18033805,18034256-180343... 29 6.5 10_08_0115 + 14924463-14924939 29 6.5 08_02_1258 - 25670092-25670152,25671124-25671327,25671400-256716... 29 6.5 08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384,748... 29 6.5 08_01_0619 + 5412058-5413224,5413357-5413476,5413755-5413831,541... 29 6.5 08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180,526... 29 6.5 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 29 6.5 08_01_0207 - 1647168-1647251,1647583-1647726,1648176-1648287,164... 29 6.5 07_03_1751 - 29215074-29216270 29 6.5 07_03_0965 - 22996575-22999112,22999202-22999636,22999717-229998... 29 6.5 06_03_1326 - 29355467-29355817 29 6.5 06_03_0790 - 24636805-24637770 29 6.5 06_03_0647 + 23122074-23122187,23123423-23123488,23124467-231246... 29 6.5 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 29 6.5 03_06_0348 - 33299824-33300234 29 6.5 03_02_0131 - 5796564-5796605,5797188-5797421,5798415-5798717,579... 29 6.5 03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021,510... 29 6.5 01_06_1104 - 34551466-34551572,34552019-34553057 29 6.5 01_06_1007 - 33733500-33733604,33733837-33733917,33734191-337342... 29 6.5 01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536,787... 29 6.5 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 26 6.8 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 25 6.8 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 24 7.2 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 7.3 12_01_0742 - 6656464-6656739 29 8.6 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 29 8.6 12_01_0252 + 1868670-1869200,1870167-1871120 29 8.6 11_06_0610 - 25449085-25453284 29 8.6 11_06_0562 + 25003246-25003746,25004975-25005214,25005576-250060... 29 8.6 11_01_0242 - 1862106-1862210,1862302-1862320,1863082-1863257,186... 29 8.6 10_08_1026 + 22400551-22401161,22401437-22401632,22401837-224018... 29 8.6 10_07_0161 - 13674631-13675433,13675793-13675862 29 8.6 10_01_0129 + 1535823-1537196 29 8.6 08_01_0394 - 3487360-3488229 29 8.6 07_03_0177 - 14770777-14772045 29 8.6 07_01_0378 + 2826421-2826427,2827286-2827375,2827400-2827639,282... 29 8.6 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 29 8.6 06_03_1172 - 28147957-28148274,28149362-28149877 29 8.6 06_01_0561 - 3983308-3983564,3983652-3983775 29 8.6 05_03_0626 - 16335816-16335917,16336331-16336558,16336694-163369... 29 8.6 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 29 8.6 04_04_0057 + 22410167-22411330 29 8.6 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 29 8.6 01_06_1293 - 36050847-36051304,36052343-36052826 29 8.6 01_01_0130 + 1182504-1182817,1183024-1183152,1183582-1183716,118... 29 8.6 06_01_0738 + 5458182-5458374,5460512-5461766,5461861-5462053,546... 25 9.2 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 43.2 bits (97), Expect = 4e-04 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = +3 Query: 48 PLXGGITFLXXGXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 PL GG G G P G GGG PP GGGGAP GGGG Sbjct: 100 PLGGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGG 152 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/60 (38%), Positives = 25/60 (41%) Frame = +1 Query: 28 VQL*AXGPXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 ++L P G L G PP GGG GGPP PP GG P GGGG Sbjct: 85 IKLLGLPPGGGGAPGPLGGGGARPPGGGGG---GGPPSLPPGAGGGGGARPPAPGGGGGG 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G GPP G GGG PP P GGGG P GGGG Sbjct: 112 GGGGGPPSLPPGAGGGGGARPPAPGG-GGGGGAPRRVLGGGG 152 Score = 36.7 bits (81), Expect = 0.032 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = +3 Query: 27 GXAVSXRPLXGGITFLXXGXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G RP GG G G P GGG GGGP P GGGG P GGGG Sbjct: 153 GGGALARPPGGG-----RGGALGRPPGGGGG-GGGPGRAP---GGGGGGGGPGRAPGGGG 203 Score = 35.5 bits (78), Expect = 0.075 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G PP GGG GGGP P GGGG P GGGG Sbjct: 167 GALGRPPGGGGG--GGGPGRAP---GGGGGGGGPGRAPGGGG 203 Score = 35.5 bits (78), Expect = 0.075 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGG--------GGAPXXXXGGGG 206 G GP GGG GGG P P GG GGAP GGGG Sbjct: 177 GGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGLGGGGGEGGAPERVIGGGG 226 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 P GGG GGG P GGGG GGGG Sbjct: 369 PKDISGGGGGGGGMLDKPDEAGGGGGGGSGGGGGGGG 405 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G P GGG GGG PP G G P GGGG Sbjct: 139 GGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGG 180 Score = 33.1 bits (72), Expect = 0.40 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG P GGGG+ GGGG Sbjct: 375 GGGGGGGMLDKPDEAGGGGGGGSGGGGGGGGG 406 Score = 31.9 bits (69), Expect = 0.92 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 P GG GGG P GGGG GGGG Sbjct: 369 PKDISGGGGGGGGMLDKPDEAGGGGGGGSGGGGGGGG 405 Score = 31.9 bits (69), Expect = 0.92 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 109 GGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 GGG GGG P GGGG GGGG Sbjct: 374 GGGGGGGGMLDKPDEAGGGGGGGSGGGGGGGGG 406 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 P P G PP GGG GG PP PP GG P Sbjct: 98 PGPLGGGGARPP------GGGGGGGPPSLPPGAGGGGGARP 132 Score = 30.3 bits (65), Expect = 2.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G P GG GGG PP G G P GGGG Sbjct: 139 GGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGG 180 Score = 29.9 bits (64), Expect = 3.7 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 P P GA PP GGG GGPP PP GG P Sbjct: 98 PGPLGGGGARPP-----GGGGGGGPPSLPP-GAGGGGGARP 132 Score = 29.9 bits (64), Expect = 3.7 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 72 LXXGXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 L G G GG GG PP GGGG P GGGG Sbjct: 148 LGGGGGGGALARPPGGGRGGALGRPPGGG--GGGGGPGRAPGGGG 190 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 99 PXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 P GGG GGG P GGGGA GGG Sbjct: 132 PPAPGGGGGGGAPRR--VLGGGGGGGALARPPGGG 164 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -1 Query: 199 PPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PP G PP GG G PP P GG Sbjct: 108 PPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGG 142 Score = 29.1 bits (62), Expect = 6.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 112 GGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 GG GG PP GGGG P GGGG Sbjct: 162 GGGRGGALGRPP---GGGGGGGGPGRAPGGGG 190 Score = 29.1 bits (62), Expect = 6.5 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G GP GG GGG P P GGGG G GG Sbjct: 177 GGGGGPGRAPGGGGGGGGPGRAP--GGGGGGGGLGGGGGEGG 216 Score = 29.1 bits (62), Expect = 6.5 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GG G G PP P GGGG GGGG Sbjct: 326 GEIAGTVDLRGGGGGAGGVFPPTPDLGGGGGG------GGGG 361 Score = 28.7 bits (61), Expect = 8.6 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G P GG GGG P GGGG GGGG Sbjct: 176 GGGGGGPGRAPGGGGGG----GGPGRAPGGGGGGGGLGGGGG 213 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 7/59 (11%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPP-------PXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPP G PPP G GG GGPP P PP GGP P +P G Sbjct: 1174 PPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPPPPGGRGLPAPPGG 1232 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 7/59 (11%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXP-------PPXXXGGPXFXPXXRXVIPPSRG 47 PPP G PPP G G GGPP P PP GGP P R + P G Sbjct: 1174 PPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPPPPGGRGLPAPPGG 1232 Score = 38.3 bits (85), Expect = 0.011 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PPPP G PPPP GG P P P G P P P P A Sbjct: 1112 PPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPA 1167 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PP P G PPPP GG G P P PP GG V PP Sbjct: 1139 PPLPEGIGGVPPPPPV---GGLGGPPAPPPPAGFRGGTPPPNAHGGVAPP 1185 Score = 36.7 bits (81), Expect = 0.032 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP G PPPP GG PP P P GG Sbjct: 1112 PPPPGGITGVPPPPPIGGLGGHQA-PPAPPLPEGIGG 1147 Score = 35.5 bits (78), Expect = 0.075 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP GG G PP PPP G Sbjct: 1099 PPPPSIGAGAPPPPPPP---GGITGVPP--PPPIGG 1129 Score = 33.1 bits (72), Expect = 0.40 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXG 198 PP GG GGPP PPPP GG P G Sbjct: 1150 PPPPVGGL--GGPPAPPPPAGFRGGTPPPNAHGG 1181 Score = 32.7 bits (71), Expect = 0.53 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 11/65 (16%) Frame = -3 Query: 206 PPPPXXXXG---XPPPPXXXXGG----GGXGGPPPXXPPP----XXGGPXFXPXXXEXNS 60 PPPP G PPPP GG GG P PPP GGP P Sbjct: 1150 PPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPAPPM 1209 Query: 59 PXXGP 45 P P Sbjct: 1210 PPGVP 1214 Score = 32.3 bits (70), Expect = 0.69 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXXGXP--PPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPP G GG PP P GG P P P Sbjct: 1109 PPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPP 1164 Score = 31.9 bits (69), Expect = 0.92 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 14/56 (25%) Frame = -1 Query: 205 PPPPXXXXG----APPPPXXXXGG----------GXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PPPP GG GG PP PP GGP P Sbjct: 1109 PPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPP 1164 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PP P G PPPP GG G P P P GG Sbjct: 1139 PPLPEGIGGVPPPPPV---GGLGGPPAPPPPAGFRGG 1172 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 72 LXXGXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXG 197 L G PP GG GG PP PPP GG P G Sbjct: 1141 LPEGIGGVPPPPPVGGLGG-PPAPPPPAGFRGGTPPPNAHGG 1181 Score = 29.9 bits (64), Expect = 3.7 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +3 Query: 96 PPXXXGGGXGGGP--PXXPPPXXXXGGGGAPXXXXGGGG 206 PP GG GG P P P P G G P GG G Sbjct: 1187 PPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPPPPGGRG 1225 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXP--PPPXXXXGGGGXPXXXXGGGG 207 PP G G GG P P P P G G P GG G Sbjct: 1187 PPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPPPPGGRG 1225 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 P PP PPP G GG PP PPP Sbjct: 1060 PSPP----SPPPPQRENTSVGIQGGIPPLPPP 1087 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PP G PPP G PPP PPP G Sbjct: 1089 PPTLGDYGVAPPPPSIGA----GAPPPPPPPGGITG 1120 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP +PPPP GG GGPPP PP P P Sbjct: 354 PPPPPPKGPSPPPPPPP--GGKKGGPPPPPPKGGASRPPAAP 393 Score = 39.5 bits (88), Expect = 0.005 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP PPPP GG GGPPP PPP G Sbjct: 355 PPPPPKGPSPPPPPPP---GGKKGGPPP--PPPKGG 385 Score = 38.7 bits (86), Expect = 0.008 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP APPPP P PPP GP P + PP Sbjct: 316 PPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPP 365 Score = 38.7 bits (86), Expect = 0.008 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP G PPP P GGP P + P P Sbjct: 344 PPPPPPAKGPPPPPPPK----GPSPPPPPPPGGKKGGPPPPPPKGGASRPPAAP 393 Score = 38.3 bits (85), Expect = 0.011 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP GPPP PPP P P Sbjct: 328 PPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPP 369 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP GPPP PP P P + P P Sbjct: 328 PPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPP 381 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP G PPPP G PPP P G P P PP+ Sbjct: 344 PPPPPPAKGPPPPPPPK---GPSPPPPPPPGGKKGGPPPPPPKGGASRPPA 391 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP P PPP GP P + P P Sbjct: 316 PPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPP 369 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP 116 PPPP G PPPP G P P Sbjct: 367 PPPPGGKKGGPPPPPPKGGASRPPAAPGVP 396 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +2 Query: 236 PPPPPPPXXXXXXXXFXXGG--GGXXPPP 316 PPPPPPP GG GG PPP Sbjct: 353 PPPPPPPKGPSPPPPPPPGGKKGGPPPPP 381 Score = 28.7 bits (61), Expect = 8.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPP G G PPP Sbjct: 353 PPPPPPPKGPSPPPPPPPGGKKGGPPPP 380 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 41.9 bits (94), Expect = 9e-04 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP GAPPPP G GGPPP PP Sbjct: 614 PPPPPRPPGAPPPPPPP---GKPGGPPPPPP 641 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP G GGPPP PPP G Sbjct: 614 PPPPPRPPGAPPPPPPP---GKPGGPPP--PPPRPG 644 Score = 32.7 bits (71), Expect = 0.53 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIP 59 PPPP G PPP PPP GGP P +P Sbjct: 614 PPPPPRPPGA-----PPPPPPPGKPGGPPPPPPRPGSLP 647 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 41.9 bits (94), Expect = 9e-04 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP GAPPPP G GGPPP PPP Sbjct: 920 PPPPRPPGAPPPPPPP---GKPGGPPPPPPP 947 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP G GGPPP PPP Sbjct: 920 PPPPRPPGAPPPPPPP----GKPGGPPPPPPPP 948 Score = 32.7 bits (71), Expect = 0.53 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = -1 Query: 178 APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIP 59 +PPPP G PPP PPP GGP P +P Sbjct: 919 SPPPPRPP------GAPPPPPPPGKPGGPPPPPPPPGSLP 952 Score = 29.5 bits (63), Expect = 4.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPP 153 PP G GG PP PPPP Sbjct: 930 PPPPPPGKPGGPPPPPPPP 948 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPPP PPP PPP P PP R +L P Sbjct: 83 PPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPP 142 Score = 37.1 bits (82), Expect = 0.024 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP G PPP PPP Sbjct: 82 PPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPP 114 Score = 32.7 bits (71), Expect = 0.53 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP PPPP PPP PPP P Sbjct: 96 PPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPP 133 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP PPPP PPP P P P P Sbjct: 84 PPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPP 125 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGG--GGXGGPPP--XXPPPXXGGP 93 PPP G PPP G G PPP PPP GP Sbjct: 22 PPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGP 62 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 2/59 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG--GGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAY 36 PPP G PPP PPP PPP F P + P P Y Sbjct: 31 PPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMY 89 Score = 29.5 bits (63), Expect = 4.9 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPP PP PPP P Sbjct: 95 PPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPP 132 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 38.3 bits (85), Expect = 0.011 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP--PPXXGGPXF 87 P PP G PPPP G GG G PPP P P G P F Sbjct: 361 PRPPGPGPG-PPPPPGAAGRGGGGPPPPALPGGPRARGPPPF 401 Score = 37.9 bits (84), Expect = 0.014 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = -1 Query: 205 PPPPXXXXGA---PPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP A PPP G GPPP PPP P Sbjct: 321 PPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAP 361 Score = 36.3 bits (80), Expect = 0.043 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPP APPPP G PP PPP P PP G Sbjct: 323 PPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPG 375 Score = 36.3 bits (80), Expect = 0.043 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXG-GPPPXXPPPXXGGP 93 PPP PPPP G G GPPP PP P Sbjct: 323 PPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAP 361 Score = 35.1 bits (77), Expect = 0.099 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 P PP G PPPP G GG P PPP GGP Sbjct: 361 PRPPGPGPGPPPPPG---AAGRGGGGP--PPPALPGGP 393 Score = 33.1 bits (72), Expect = 0.40 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 8/46 (17%) Frame = -3 Query: 206 PPPPXXXXGXP--------PPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP P PPP G G GGPP PP GGP Sbjct: 351 PPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPP---PPALPGGP 393 Score = 32.7 bits (71), Expect = 0.53 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP AP PP G GPPP P GG P P +RG Sbjct: 351 PPPPPAAPAAPRPP------GPGPGPPPPPGAAGRGGGGPPPPALPGGPRARG 397 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP G PPP GG GPPP P Sbjct: 371 PPPPGAAGRGGGGPPPPALPGGPRARGPPPFKKSP 405 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPP G P PPP Sbjct: 322 PPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPP 354 Score = 29.5 bits (63), Expect = 4.9 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +1 Query: 124 GGGPPXPPPP-XXXXGGGGXPXXXXGGG 204 G GP PPPP GGGG P GG Sbjct: 365 GPGPGPPPPPGAAGRGGGGPPPPALPGG 392 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 G PP G GGGPP P P G P Sbjct: 367 GPGPPPPPGAAGRGGGGPPPPALPGGPRARGPPP 400 Score = 28.7 bits (61), Expect = 8.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 117 GXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 G G GPP PP GGGG P GG Sbjct: 365 GPGPGPP-PPPGAAGRGGGGPPPPALPGG 392 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 38.3 bits (85), Expect = 0.011 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPP PPP GGGG G PPP PPP Sbjct: 74 PPPSPDYYDPPPSPYYGGGGGYGKPPP--PPP 103 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 38.3 bits (85), Expect = 0.011 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGG--XGGPPPXXP 114 PPPP PPPP GGGG GPPP P Sbjct: 8 PPPPPPPPQHPPPPQAGGGGGGEFYRGPPPQPP 40 Score = 38.3 bits (85), Expect = 0.011 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXX--GGPPPXPP 113 PPPP PPPP GGG GPPP PP Sbjct: 8 PPPPPPPPQHPPPPQAGGGGGGEFYRGPPPQPP 40 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGG--XXPPP 316 PPPPPPPP GGG PPP Sbjct: 8 PPPPPPPPQHPPPPQAGGGGGGEFYRGPPP 37 >01_07_0082 - 40965947-40967023 Length = 358 Score = 37.9 bits (84), Expect = 0.014 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP 126 PPPP G PPPP GGG G PP Sbjct: 268 PPPPQAGYGYPPPPPQAGYGGGYGYPP 294 Score = 34.7 bits (76), Expect = 0.13 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP 125 PPPP G PPPP GG G PP Sbjct: 268 PPPPQAGYGYPPPPPQAGYGGGYGYPP 294 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXF-XPXXRXVIPPSRGLKLTAX 29 PPPP PPPP PPP PPP P +P SR L Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLPKPAEPPAVPTSRRRLLKPL 409 Query: 28 P 26 P Sbjct: 410 P 410 Score = 33.9 bits (74), Expect = 0.23 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP PPP PPP Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 29.5 bits (63), Expect = 4.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPPXXP 558 PP P PPP K PPPP P Sbjct: 351 PPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPPXXP 558 PP P PPP K PPPP P Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPP 379 >10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081, 7040633-7041213 Length = 426 Score = 36.3 bits (80), Expect = 0.043 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP P P GGG PPP PPP Sbjct: 75 PPPPSMPGPLPAPYDHHHRGGGPAQPPPPPPPP 107 Score = 33.1 bits (72), Expect = 0.40 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP G P P GG PP PPP Sbjct: 74 PPPPPSMPGPLPAPYDHHHRGGGPAQPPPPPPP 106 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXX---GGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G P P GG PPP PP F P Sbjct: 74 PPPPPSMPGPLPAPYDHHHRGGGPAQPPPPPPPPQPIHAAGEFPP 118 >03_05_0732 - 27232299-27232535,27232717-27232746,27233094-27233155, 27233975-27234005,27234618-27234713,27234881-27234969, 27235687-27236263 Length = 373 Score = 36.3 bits (80), Expect = 0.043 Identities = 22/66 (33%), Positives = 24/66 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP P P P PPP G P F P R P RG L A Sbjct: 54 PPPPPPPPPLPQPQHHHDAVSTDESRTPPPPPPPMGAPGFGP-FRWSPRPLRGAPLAAWD 112 Query: 25 SXSXVQ 8 + S V+ Sbjct: 113 AASPVR 118 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 36.3 bits (80), Expect = 0.043 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PP GG PPP PPP G P P Sbjct: 282 PPPPNAPMGMPPRIPPPPVGGTQ--PPPPPPPLANGPPRSIP 321 Score = 31.9 bits (69), Expect = 0.92 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PP GG PPP PP G P P Sbjct: 282 PPPPNAPMGMPPRIPPPPVGGTQ--PPPPPPPLANGPPRSIP 321 Score = 31.1 bits (67), Expect = 1.6 Identities = 20/73 (27%), Positives = 20/73 (27%) Frame = -1 Query: 313 GGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXG 134 G G PP P PPPP PPPP G Sbjct: 260 GSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLAN----G 315 Query: 133 GPPPXPPPXXXGG 95 P PPP GG Sbjct: 316 PPRSIPPPPMTGG 328 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP P P G PP PPP G P N P Sbjct: 267 PPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGP 316 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 6/44 (13%) Frame = -1 Query: 205 PPPPXXXXGAPP---PPXXXXGGGXXG---GPPPXPPPXXXGGP 92 PPPP PP PP GG G PP PP GP Sbjct: 306 PPPPPPLANGPPRSIPPPPMTGGAMANFTPGAPPRPPMQGFPGP 349 Score = 29.9 bits (64), Expect = 3.7 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP P P G PP PPP G P P R + Sbjct: 267 PPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRSI 320 >02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787, 6435281-6435392,6435473-6435517,6435622-6435726, 6435946-6435996,6436026-6436103,6437258-6437313, 6437784-6437853,6438288-6438392,6438525-6438637, 6439354-6439534,6439635-6440390 Length = 710 Score = 36.3 bits (80), Expect = 0.043 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -3 Query: 206 PPPPXXXXGXP-PPPXXXXGGGGXGGPPP 123 PPPP G P PPP GGG G PPP Sbjct: 65 PPPPGMLHGEPYPPPDRFGYGGGRGYPPP 93 Score = 33.5 bits (73), Expect = 0.30 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -1 Query: 205 PPPPXXXXGAP-PPPXXXXGGGXXGGPPP 122 PPPP G P PPP GG G PPP Sbjct: 65 PPPPGMLHGEPYPPPDRFGYGGGRGYPPP 93 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 36.3 bits (80), Expect = 0.043 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +1 Query: 97 PPXXGGGXX---GGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GGG GGG PPP GGGG GGGG Sbjct: 95 PPYSGGGGGSSTGGGGIYYPPPTGGGGGGGGGWQQGGGGG 134 Score = 33.9 bits (74), Expect = 0.23 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -3 Query: 206 PPPPXXXXGX--PPPPXXXXGGGGXGGPP----PXXPPPXXGG 96 PPPP PPPP GGGG GG PPP GG Sbjct: 58 PPPPVVTPTPQCPPPPSYPSGGGGGGGGGTVMYTSPPPPYSGG 100 Score = 32.3 bits (70), Expect = 0.69 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +3 Query: 99 PXXXGGGXGGGPP--XXPPPXXXXGGGGAPXXXXGGGG 206 P GGG GGG PPP GGGG+ GGGG Sbjct: 76 PSGGGGGGGGGTVMYTSPPPPYSGGGGGS---STGGGG 110 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = -3 Query: 176 PPPPXXXXGGG-GXGGPPPXXPPPXXGG 96 PPPP GGG GG PPP GG Sbjct: 93 PPPPYSGGGGGSSTGGGGIYYPPPTGGG 120 Score = 29.9 bits (64), Expect = 3.7 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +3 Query: 96 PPXXXGGGX---GGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 PP GGG GGG PPP GGGG GGG Sbjct: 95 PPYSGGGGGSSTGGGGIYYPPPTG--GGGGGGGGWQQGGG 132 Score = 28.7 bits (61), Expect = 8.6 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -1 Query: 178 APPPPXXXXGGG--XXGGPPPXPPPXXXGG 95 +PPPP GGG GG PPP GG Sbjct: 92 SPPPPYSGGGGGSSTGGGGIYYPPPTGGGG 121 >09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052, 1741559-1741641,1741733-1741784,1742038-1742105, 1742279-1742345,1742426-1742505,1742576-1742640, 1742785-1742847,1743271-1743427,1743511-1743588, 1743677-1744219,1744321-1744497,1744534-1744788, 1745270-1745329,1745874-1745888,1746123-1746135, 1746819-1746934 Length = 793 Score = 35.5 bits (78), Expect = 0.075 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 46 GPXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 GP G GP G GGG PP GGGG GGGG Sbjct: 14 GPAPGSRGGGDGRFGRGPSRWSSGGGGGGSGSPPHRFSRGGGGGGGDGGGGGGG 67 Score = 29.5 bits (63), Expect = 4.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG G G PP GGGG GGGG Sbjct: 38 GGGGGSG---SPPHRFSRGGGGGGGDGGGGGG 66 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 35.1 bits (77), Expect = 0.099 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP PPPP G PPP PPP Sbjct: 641 PPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPP 672 Score = 34.3 bits (75), Expect = 0.17 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPP G PPP PPP Sbjct: 640 PPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPP 671 Score = 33.1 bits (72), Expect = 0.40 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPPP G PP PPP P P G K A P Sbjct: 712 PPPP------PPPPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPPPPLMTGKKAPAPP 765 Score = 32.7 bits (71), Expect = 0.53 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP G PPP PPP Sbjct: 544 PPPP------PPPPPPPSGNKPAFSPPPPPPP 569 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP PPP PPP Sbjct: 563 PPPPPP---PPPPPPLPQSNYASSQPPPPPPPP 592 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP PPP PPP Sbjct: 563 PPPPPP---PPPPPPLPQSNYASSQPPPPPPP 591 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PP G G PPP PPP Sbjct: 690 PPPPPPPL---PPANRTNGPGVPSAPPPPPPP 718 Score = 29.9 bits (64), Expect = 3.7 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = -1 Query: 205 PPPPXXXXG--APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTA 32 PPPP G AP PP G P PPP P P S+GL A Sbjct: 750 PPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPPLHGASGRPHP------PSSKGLNAPA 803 Query: 31 XP 26 P Sbjct: 804 PP 805 Score = 29.5 bits (63), Expect = 4.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 P P PPPP G PP PPP Sbjct: 537 PSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPP 568 Score = 29.5 bits (63), Expect = 4.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP F PPP Sbjct: 545 PPPPPPPPPPSGNKPAFSPPPPPPPPPP 572 Score = 29.5 bits (63), Expect = 4.9 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = -1 Query: 205 PPPPXXXXGA----PPPPXXXXGGGXXGGPPPXPPP 110 PPPP + PPPP PPP PPP Sbjct: 607 PPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPP 642 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 P P PPPP G PP PPP P Sbjct: 537 PSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP + PPP Sbjct: 564 PPPPPPPPPPPLPQSNYASSQPPPPPPP 591 >06_02_0257 - 13533689-13533714,13533799-13533925,13534013-13534121, 13534193-13534272,13534758-13534979,13536070-13536318, 13537032-13537484,13539834-13540556 Length = 662 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 10/40 (25%) Frame = +1 Query: 94 GPPXXGGGXXGGG----------PPXPPPPXXXXGGGGXP 183 GPP GGG GG PP PPPP GGG P Sbjct: 42 GPPGGGGGDRRGGFQLPPDAAPPPPPPPPPSSAAAGGGGP 81 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 10/42 (23%) Frame = +3 Query: 87 KXGPPXXXGGGXGGG----------PPXXPPPXXXXGGGGAP 182 + GPP GG GG PP PPP GGG P Sbjct: 40 RRGPPGGGGGDRRGGFQLPPDAAPPPPPPPPPSSAAAGGGGP 81 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 691 GGGGGXGXGGXXPPPPXXPPXXXP 620 GGGGG GG PP PP P Sbjct: 45 GGGGGDRRGGFQLPPDAAPPPPPP 68 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 633 GGXXGGGGXXPPXPXPPPPP 692 GG GG PP PPPPP Sbjct: 48 GGDRRGGFQLPPDAAPPPPP 67 >01_06_1377 + 36764461-36765339 Length = 292 Score = 34.7 bits (76), Expect = 0.13 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = -1 Query: 205 PPPPXXXXGAPPPP-----XXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP APPPP GG PPP P GP Sbjct: 173 PPPPPPAYSAPPPPQYGSEQYYRSGGYYSAPPPPPQYEYTAGP 215 Score = 28.7 bits (61), Expect = 8.6 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 5/43 (11%) Frame = -3 Query: 206 PPPPXXXXGXPPPP-----XXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP GG PPP GP Sbjct: 173 PPPPPPAYSAPPPPQYGSEQYYRSGGYYSAPPPPPQYEYTAGP 215 >01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 Length = 301 Score = 34.7 bits (76), Expect = 0.13 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = +1 Query: 46 GPXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 GP G L S G P GGG G PP P P GGG P GGG Sbjct: 94 GPSGGALPSPSHGG--AAPSHGGG-YGASPPVTPSPGGGYGGGS-PAPSHGGG 142 Score = 33.9 bits (74), Expect = 0.23 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 93 GPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 G GGG G PP P P GGG+P GGG Sbjct: 107 GAAPSHGGGYGASPPVTPSPGGGY-GGGSPAPSHGGG 142 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 34.3 bits (75), Expect = 0.17 Identities = 24/87 (27%), Positives = 25/87 (28%), Gaps = 2/87 (2%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPP- 125 PPPP + PPPP PPPP GPP Sbjct: 1138 PPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPP---LPSGPPP 1194 Query: 124 -PXPPPXXXGGPXFXPXXRXVIPPSRG 47 P PPP P P P S G Sbjct: 1195 QPAPPPLPIQPPPIPPPPVPSSPSSLG 1221 Score = 32.7 bits (71), Expect = 0.53 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP G PP PPP P P +SP Sbjct: 1170 PPPPPLSPSLPPPPPPPPLPSGP--PPQPAPPPLPIQPPPIPPPPVPSSP 1217 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPP PPPP PP PP P P + PS Sbjct: 1129 PPPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPS 1178 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP PPPP PP PP P P SP P Sbjct: 1129 PPPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPP 1181 >07_03_1691 - 28726307-28726323,28726588-28726953,28727483-28727567, 28728255-28728387,28729793-28730328 Length = 378 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXG-GPPPXXPPP 108 P P P PP GGGG G GP P PPP Sbjct: 17 PNPNLNLPCPLPPIPSCGGGGGGAGPTPPPPPP 49 Score = 33.5 bits (73), Expect = 0.30 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPP 108 PP P GGGG G PP PPP Sbjct: 28 PPIPSCGGGGGGAGPTPPPPPPP 50 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 645 GGGGXXPPXPXPPPPP 692 GGGG P P PPPPP Sbjct: 36 GGGGAGPTPPPPPPPP 51 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 645 GGGGXXPPXPXPPPPP 692 GGGG P P PPPPP Sbjct: 35 GGGGGAGPTPPPPPPP 50 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 100 PXXGGGXXGGGPPXPPPP 153 P GGG G GP PPPP Sbjct: 31 PSCGGGGGGAGPTPPPPP 48 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 685 GGGXGXGGXXPPPPXXPP 632 GGG G G PPPP PP Sbjct: 34 GGGGGGAGPTPPPPPPPP 51 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 633 GGXXGGGGXXPPXPXPPP 686 GG GG G PP P PPP Sbjct: 34 GGGGGGAGPTPPPPPPPP 51 Score = 29.5 bits (63), Expect = 4.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 688 GGGGXGXGGXXPPPPXXP 635 GGGG G G PPPP P Sbjct: 34 GGGGGGAGPTPPPPPPPP 51 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PP G GPPP PPP GP Sbjct: 406 PPPPP---GLPPAQMQMAPFGVPPGPPPMLPPPFYPGP 440 Score = 33.5 bits (73), Expect = 0.30 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP G G P P PPP G P Sbjct: 230 PPPP------PPPPKPANIAGAPGLPLPPPPPPPPGPP 261 Score = 33.1 bits (72), Expect = 0.40 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP PPPP G G P P PPP G P Sbjct: 230 PPPP------PPPPKPANIAGAPGLPLPPPPPPPPGPP 261 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP G PP G GPPP PP GP Sbjct: 406 PPPPP---GLPPAQMQMAPFGVPPGPPPMLPPPFYPGP 440 >07_01_0080 + 587674-588510 Length = 278 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXF 86 PPPP G+PPPP PPP PPP P F Sbjct: 94 PPPPPPSSGSPPPPP----------PPPPPPPPPPPPPLF 123 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPPP PPP PPP P Sbjct: 94 PPPPPPSSGSPPPP-----------PPPPPPPPPPPPP 120 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPP PPP P Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPPP 119 Score = 29.9 bits (64), Expect = 3.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPP PPP P Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 169 PPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PP G PPP PPP G P P PP Sbjct: 79 PPRLGGDGMFRRPPPPPPPPPSSGSPPPPPPPPPPPPP 116 Score = 29.1 bits (62), Expect = 6.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 206 PPPPXX-XXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 PPPP G PPPP PPP PPP P F Sbjct: 93 PPPPPPPSSGSPPPPP----------PPPPPPPPPPPPPLF 123 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 33.9 bits (74), Expect = 0.23 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXE---XNSPXXGPXA 39 PPPP PPPP P P PP GP P N+P P A Sbjct: 35 PPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPGPAAAPSPHSPSPSNAPWVAPAA 93 Score = 29.1 bits (62), Expect = 6.5 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 4/57 (7%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGG----GXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PP P A PPP G PPP P P P P PP G Sbjct: 15 PPRPTPAPQATPPPAIPESGPPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPG 71 >09_02_0495 + 9880714-9881196 Length = 160 Score = 33.9 bits (74), Expect = 0.23 Identities = 22/53 (41%), Positives = 24/53 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP G PP GGG GP P PPP P F P + N+P G Sbjct: 81 PPPPGVMPGAFAPPF---GGGFPYGPAP--PPPNPILPWF-PWYYQHNNPITG 127 Score = 33.1 bits (72), Expect = 0.40 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP GA PP GGG GP P PP Sbjct: 81 PPPPGVMPGAFAPPF---GGGFPYGPAPPPP 108 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 33.9 bits (74), Expect = 0.23 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 181 GAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 G PPPP G PPP PPP G Sbjct: 183 GPPPPPPPQPSGDANENPPPPPPPLRTG 210 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 182 GXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 G PPPP G PPP PP G Sbjct: 183 GPPPPPPPQPSGDANENPPPPPPPLRTG 210 Score = 23.8 bits (49), Expect(2) = 6.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 233 PPPPPPP 253 PPPPPPP Sbjct: 184 PPPPPPP 190 Score = 23.8 bits (49), Expect(2) = 6.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 236 PPPPPPP 256 PPPPPPP Sbjct: 200 PPPPPPP 206 >07_03_0866 - 22134215-22135351 Length = 378 Score = 33.9 bits (74), Expect = 0.23 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 100 PXXGGGXXGGG---PPXPPPPXXXXGGGGXPXXXXGGG 204 P GGG GG PP PP P GGG GGG Sbjct: 9 PRAGGGGSGGSQHTPPLPPAPHGNGHGGGGGGGGGGGG 46 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 99 PXXXGGGXGGG---PPXXPPPXXXXGGGGAPXXXXGGG 203 P GGG GG PP P P GGG GGG Sbjct: 9 PRAGGGGSGGSQHTPPLPPAPHGNGHGGGGGGGGGGGG 46 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 33.9 bits (74), Expect = 0.23 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 P PP APPPP G GPP PPP G P Sbjct: 589 PSPPPAPKAAPPPPPPKSTGP---GPPRPPPPAMPGSSKTRP 627 Score = 33.9 bits (74), Expect = 0.23 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = -1 Query: 205 PPPPXXXXGAP-PPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAX 29 PPP G P PPP G PPP P G + + P K+TA Sbjct: 602 PPPKSTGPGPPRPPPPAMPGSSKTRPPPPLKPGAKVGAVENSNEAKTKLKPFFWDKVTAN 661 Query: 28 PSXSXV 11 P+ S V Sbjct: 662 PARSMV 667 Score = 31.9 bits (69), Expect = 0.92 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXP 114 PPP PPPP G G PPP P Sbjct: 591 PPPAPKAAPPPPPPKSTGPGPPRPPPPAMP 620 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 P PP PPPP G G PPP P Sbjct: 589 PSPPPAPKAAPPPPPPKSTGPGPPRPPPPAMP 620 >03_01_0515 - 3864796-3865425 Length = 209 Score = 33.9 bits (74), Expect = 0.23 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP +PPPP PP PPP Sbjct: 73 PPPPPSVTSSPPPPPLPPPPPPPAASPPPPPP 104 Score = 33.9 bits (74), Expect = 0.23 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP PPPP PPP PP P Sbjct: 74 PPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSP 111 Score = 33.5 bits (73), Expect = 0.30 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP PPP P P P Sbjct: 74 PPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSP 111 Score = 33.1 bits (72), Expect = 0.40 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP-PXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP PP P PPP P P SP Sbjct: 61 PPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSP 111 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP PPPP PPP PPP P PPS Sbjct: 61 PPPPAAGPLMPPPPPPPSVTSSPP-PPPLPPPPPPPAASPPPPPPSPPPPS 110 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP 116 PPPP PPPP PPP P Sbjct: 91 PPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP PPPP PP PP Sbjct: 90 PPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 29.5 bits (63), Expect = 4.9 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -1 Query: 205 PP--PPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PP PP +PPPP G PPP PPP P P PP+ Sbjct: 49 PPLAPPPSVTSSPPPP----AAGPLMPPPP-PPPSVTSSPPPPPLPPPPPPPA 96 >06_03_0927 + 26015956-26018230,26018323-26018471,26018550-26018618, 26018701-26018853,26018927-26019090,26019207-26019354, 26020348-26020470,26020560-26020647,26020781-26020950 Length = 1112 Score = 33.5 bits (73), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 182 GXPPPPXXXXGGGGXGGPPPXXPP 111 G PPPP GGGG GG P P Sbjct: 164 GGPPPPAPTSGGGGGGGSPTALSP 187 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 181 GAPPPPXXXXGGGXXGGPPPXPPP 110 G PPPP GGG GG P P Sbjct: 164 GGPPPPAPTSGGGGGGGSPTALSP 187 Score = 29.5 bits (63), Expect = 4.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 127 GGPPXPPPPXXXXGGGGXP 183 GGPP P P GGGG P Sbjct: 164 GGPPPPAPTSGGGGGGGSP 182 >05_02_0161 + 7199005-7199505,7200118-7200378,7201532-7201621 Length = 283 Score = 33.5 bits (73), Expect = 0.30 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP PPPP G GG PP GG Sbjct: 51 PPPPDDGGEFPPPPDDGGEGVSEGGAGVAGPPEADGG 87 Score = 32.3 bits (70), Expect = 0.69 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP PPPP G GG PP GG Sbjct: 51 PPPPDDGGEFPPPPDDGGEGVSEGGAGVAGPPEADGG 87 >04_04_0053 + 22389227-22389613,22390528-22390981,22391618-22391673, 22391757-22391887,22391976-22392072,22393329-22393484 Length = 426 Score = 33.5 bits (73), Expect = 0.30 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP APPPP GPPP Sbjct: 51 PPPPPPMVAAPPPPPPQYAKHFAAGPPP 78 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP 123 PPPP PPPP GPPP Sbjct: 51 PPPPPPMVAAPPPPPPQYAKHFAAGPPP 78 >01_06_1792 - 39912714-39913559 Length = 281 Score = 33.5 bits (73), Expect = 0.30 Identities = 19/52 (36%), Positives = 21/52 (40%) Frame = +3 Query: 27 GXAVSXRPLXGGITFLXXGXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAP 182 G S P GG + + G P GGG G P PPP G G AP Sbjct: 152 GYGGSNSPYGGGSSIIISGAAPIPHNNFGGGGTGWP--VPPPPQDGGSGAAP 201 Score = 32.3 bits (70), Expect = 0.69 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 182 GXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 G P P GGGG G P P PPP GG P Sbjct: 170 GAAPIPHNNFGGGGTGWPVP--PPPQDGGSGAAP 201 Score = 29.5 bits (63), Expect = 4.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 181 GAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 GA P P GGG G P P PP G Sbjct: 170 GAAPIPHNNFGGGGTGWPVPPPPQDGGSG 198 >07_01_0479 + 3606663-3607448 Length = 261 Score = 33.1 bits (72), Expect = 0.40 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 205 PP--PPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PP PP G PPPP G GPP P GGP P R +PP Sbjct: 190 PPGVPPAFPGGPPPPPGPFMRGPPPMGPPQV-RPGMPGGP--PPGMRPGMPP 238 Score = 29.5 bits (63), Expect = 4.9 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPP G G PP P P F P Sbjct: 202 PPPPGPFMRGPPPMGPPQVRPGMPGGPPPGMRPGMPPPPFRP 243 >02_05_0002 - 24849189-24849825,24850267-24850328 Length = 232 Score = 33.1 bits (72), Expect = 0.40 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 173 PPPXXXXGGGGXGGPPPXXPPPXXGG 96 P P GGGG PPP PPP G Sbjct: 204 PQPADTSGGGGHPHPPPPPPPPPSAG 229 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 645 GGGGXXPPXPXPPPPP 692 GGGG P P PPPPP Sbjct: 211 GGGGHPHPPPPPPPPP 226 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 172 PPPXXXXGGGXXGGPPPXPPPXXXGG 95 P P GGG PPP PPP G Sbjct: 204 PQPADTSGGGGHPHPPPPPPPPPSAG 229 Score = 29.5 bits (63), Expect = 4.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXG 99 P P GGG PPP PPP G Sbjct: 204 PQPADTSGGGGHPHPPPPPPPPPSAG 229 >02_01_0302 - 2021221-2023305 Length = 694 Score = 33.1 bits (72), Expect = 0.40 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP PP GGG GG PP P G F P Sbjct: 637 PPPTPHNCSPPSHGSSTGGGHGGGHPPSTSTPPGGKLPFPP 677 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPP +PP GGG GG PP G F P Sbjct: 637 PPPTPHNCSPPSHGSSTGGGHGGGHPPSTSTPPGGKLPFPP 677 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 173 PPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 P P G GG G P P PP GP P Sbjct: 387 PTPGGSPGRGGQGPPAPVSSPPRRRGPYPQP 417 >07_03_0329 + 16840051-16840917,16840999-16841342,16841444-16841574, 16841671-16841792,16841877-16841983,16842104-16842236, 16842342-16842458,16842560-16842667,16842716-16842742, 16842759-16842830,16843462-16843584,16843671-16843833, 16844140-16844264,16844355-16844489,16844574-16844677, 16844772-16844834,16844930-16844993,16845186-16845318, 16845414-16845487,16845603-16845697,16845799-16845830, 16846201-16846355 Length = 1097 Score = 32.7 bits (71), Expect = 0.53 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 99 PXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 P GGG GGG PP GGGG GGGG Sbjct: 52 PGGRGGGYGGGGGGGGPPYYGGGGGGG----GGGGG 83 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 100 PXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 P GG GGG PP GGGG GGGG Sbjct: 52 PGGRGGGYGGGGGGGGPPYYGGGGGG----GGGGGG 83 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 32.7 bits (71), Expect = 0.53 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGG 141 PPPP PPPP GGGG Sbjct: 55 PPPPPTQPAPPPPPPARSGGGG 76 Score = 31.9 bits (69), Expect = 0.92 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGG 141 PPPP PPPP GGGG Sbjct: 56 PPPPTQPAPPPPPPARSGGGGG 77 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXG 135 PPPP PPPP GGG G Sbjct: 54 PPPPPPTQPAPPPPPPARSGGGGG 77 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXG 134 PPPP APPPP GG G Sbjct: 54 PPPPPPTQPAPPPPPPARSGGGGG 77 Score = 29.9 bits (64), Expect = 3.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -1 Query: 178 APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 APPPP PPP PPP P P Sbjct: 37 APPPPARHRAPSPPRPPPPPPPPTQPAPPPPPP 69 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPP +PP P PPP PP GG Sbjct: 39 PPPARHRAPSPPRPPPPPPPPTQPAPPPPPPARSGGG 75 >08_01_0059 - 394001-394708 Length = 235 Score = 32.3 bits (70), Expect = 0.69 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPP APPPP PPP PP P P R PP L P Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPPSPPIR----PPPPPTPRPYAPPPPSHPLAPPP 56 Score = 29.5 bits (63), Expect = 4.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP APPPP PPP PPP Sbjct: 45 PPPPSHPLAPPPPHISPPAPVP--PPPSPPP 73 Score = 28.7 bits (61), Expect = 8.6 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP P PPP P P Sbjct: 25 PPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVP 66 >01_01_0553 - 4067921-4068180,4068437-4068455,4069101-4070225 Length = 467 Score = 32.3 bits (70), Expect = 0.69 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 633 GGXXGGGGXXPPXPXPPPPP 692 GG GGGG P PPPPP Sbjct: 21 GGGGGGGGFSPTAAKPPPPP 40 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 633 GGXXGGGGXXPPXPXPPPPP 692 GG GGGG P PPPP Sbjct: 20 GGGGGGGGGFSPTAAKPPPP 39 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 32.3 bits (70), Expect = 0.69 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 123 GGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG P PPP GGGG GGGG Sbjct: 389 GGGGPGAPPPYHGGGGGGG--GGGGGGG 414 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +1 Query: 58 GELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G L G G P GGG G PPP GGGG GGGG Sbjct: 372 GSLPPSYDGGYGGRPMPGGGGPGA-----PPPYHGGGGGG--GGGGGGGG 414 Score = 29.1 bits (62), Expect = 6.5 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 46 GPXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G + G G GGG GGG GGGG GGGG Sbjct: 61 GYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGGG 114 Score = 29.1 bits (62), Expect = 6.5 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 87 KXGPPXXXGGGXGGGPPXXPPPXXXXGG---GGAPXXXXGGGG 206 K G P GGG GGG GG GG GGGG Sbjct: 191 KCGAPSPAGGGGGGGGGGYNKSGGGGGGYNRGGGDFSSGGGGG 233 Score = 28.7 bits (61), Expect = 8.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 82 GGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGG 113 Score = 28.7 bits (61), Expect = 8.6 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 96 PPXXXGGGXGGGPP-XXPPPXXXXGGGGAP 182 PP GGG G PP PP GGAP Sbjct: 339 PPSSYGGGPGSYPPSYGAPPPNPPYSGGAP 368 >11_06_0557 - 24955837-24956214,24957225-24957395,24957576-24957635, 24958419-24958623,24958710-24958953,24959103-24959394, 24959734-24960828,24960915-24961409,24961665-24961823, 24961893-24962387 Length = 1197 Score = 31.9 bits (69), Expect = 0.92 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPX----PPPPXXXXGGGGXPXXXXGGGG 207 G GGG GG P PPPP G GG GGG Sbjct: 42 GEAAGGGGADGGSPASRAASPPPPTAAGGQGGVGGGPVSGGG 83 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 31.9 bits (69), Expect = 0.92 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPP PPPP PPP PPP GP Sbjct: 327 PPPAPPP--PPPPPSRFNNTTPKPPPPPPPPEPPTGP 361 >07_01_0974 + 8211602-8212051 Length = 149 Score = 31.9 bits (69), Expect = 0.92 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 178 APPPPXXXXGGGXXGGPPPXPP 113 +PPPP GGG GG P PP Sbjct: 48 SPPPPSSPVGGGGTGGGGPSPP 69 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = -3 Query: 176 PPPPXXXXGGGGX--GGP-PPXXPPP 108 PPPP GGGG GGP PP P P Sbjct: 49 PPPPSSPVGGGGTGGGGPSPPTNPAP 74 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 688 GGGGXGXGGXXPPPPXXPP 632 GGGG G GG PP PP Sbjct: 57 GGGGTGGGGPSPPTNPAPP 75 >06_03_1121 + 27767707-27768065,27768612-27769034,27770013-27770175, 27770271-27770381,27770895-27770963,27771117-27771203, 27771967-27772752 Length = 665 Score = 31.9 bits (69), Expect = 0.92 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = +3 Query: 57 GGITFLXXGXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 G ++F G PP GG GG P P GGGG GGG Sbjct: 4 GDLSFDFEGGLDQPP---AGGGGGPAPHSSDPGGVGGGGGGGGPGDGGG 49 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +1 Query: 58 GELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 G+L G PP GG GG P P GGGG GGG Sbjct: 4 GDLSFDFEGGLDQPPAGGG---GGPAPHSSDPGGVGGGGGGGGPGDGGG 49 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 31.9 bits (69), Expect = 0.92 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP PPPP GPPP PP G Sbjct: 4 PPPPPQWAMGPPPPPQY----FQAGPPPPPPQYFQG 35 Score = 31.9 bits (69), Expect = 0.92 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP G PPPP GPPP PPP Sbjct: 5 PPPPQWAMGPPPPPQYF-----QAGPPP--PPP 30 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 8/45 (17%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGG-----GXXGGPPP---XPPPXXXGG 95 PPP G PPPP G G PPP PPP GG Sbjct: 16 PPPQYFQAGPPPPPPQYFQGAHPPAAMWGQPPPPQAAPPPAPAGG 60 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 7/44 (15%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGG-------GXGGPPPXXPPPXXGG 96 PPP G PPPP G G PP PPP G Sbjct: 16 PPPQYFQAGPPPPPPQYFQGAHPPAAMWGQPPPPQAAPPPAPAG 59 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 31.9 bits (69), Expect = 0.92 Identities = 22/66 (33%), Positives = 23/66 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPP PPP PPP P P PP L+ P Sbjct: 964 PPPPPPPPNVAPPPFTRQD---IPPPPPSPPPLPITQPPSVPPPPNSPPP---LQPATDP 1017 Query: 25 SXSXVQ 8 S S Q Sbjct: 1018 SDSQKQ 1023 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 31.9 bits (69), Expect = 0.92 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 6/64 (9%) Frame = -1 Query: 205 PPPPXXXXGAP------PPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP AP PPP G PP P P G P P PP G Sbjct: 145 PPPPPTVPAAPTPRPSPPPPAAGTNGTARAPSPPVPAPAPAGSPPPPP------PPPAGG 198 Query: 43 KLTA 32 TA Sbjct: 199 NFTA 202 Score = 30.3 bits (65), Expect = 2.8 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTA 32 PPP G P G PP PPP GG P P+ G+ TA Sbjct: 162 PPPAAGTNGTARAPSPPVPAPAPAGSPPPPPPPPAGGNFTAP------SPAGGMNFTA 213 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP G P G PP PPP GG P Sbjct: 162 PPPAAGTNGTARAPSPPVPAPAPAGSPPPPPPPPAGGNFTAP 203 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 31.9 bits (69), Expect = 0.92 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPP PPP PPP P P Sbjct: 82 PPPPTPKKAPPPPVTPPPVTPPPVTPPPVSPPPATPPPALPP 123 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPP PPPP PPP PPP P P ++P Sbjct: 82 PPPPTPKKAPPPPVTPP----PVTPPPVTPPPVSPPPATPPPALPPSTP 126 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP G PPPP PPP PPP Sbjct: 413 PPPPTHTHGPPPPP-----------PPPPPPP 433 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP G PPP PPP G Sbjct: 412 PPPPPTHTHGPPP--PPPPPPPPPVG 435 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 Query: 205 PPPPXXXXGAPPPP 164 PPPP PPPP Sbjct: 358 PPPPPFAPTLPPPP 371 >09_03_0145 - 12749288-12751510 Length = 740 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/53 (37%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIP-PSR 50 PPPP G PPP G G P PPP G F V+P P+R Sbjct: 30 PPPPPPPPGIQPPPPALP--GMPHGRP--PPPFPGGRDAFPQAASTVVPDPAR 78 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP 114 PPPP G PPP G G PPP P Sbjct: 30 PPPPPPPPGIQPPPPALP-GMPHGRPPPPFP 59 Score = 29.9 bits (64), Expect = 3.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP G PPP Sbjct: 30 PPPPPPPPGIQPPPPALPGMPHGRPPPP 57 >08_02_1019 - 23657175-23658047 Length = 290 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 117 GXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G GGG P P GGGG GGGG Sbjct: 31 GLGGGGGGVPKPGGGVGGGGGGGGGGGGGG 60 Score = 28.7 bits (61), Expect = 8.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 124 GGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 GGG P P GGGG GGGG Sbjct: 33 GGGGGGVPKPGGGVGGGGGGGGGGGGGG 60 >06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700, 3363820-3364098,3364189-3364386,3364475-3365110, 3365209-3365463,3365579-3365685,3365770-3369566, 3369677-3370166,3370918-3371308,3371481-3371573, 3371687-3371810,3372544-3372791 Length = 2380 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP 123 PPPP PPPP GG GG P Sbjct: 5 PPPPGTGAPPPPPPAAVGPPGGVGGGKP 32 Score = 28.7 bits (61), Expect = 8.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP PPPP G GG P Sbjct: 5 PPPPGTGAPPPPPPAAVGPPGGVGGGKP 32 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = -3 Query: 200 PPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PP P P G G PP PPP G + P P P A Sbjct: 502 PPSSGAPTQPVPAPVYGTSGAPNAPPMYPPPPYGYASYYPSVTPVQPPPPPPPA 555 Score = 29.5 bits (63), Expect = 4.9 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = -1 Query: 181 GAPPPPXXXXGGGXXGGP--PPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXPSXS 17 GAP P G G P PP PP G + P V PP A PS S Sbjct: 506 GAPTQPVPAPVYGTSGAPNAPPMYPPPPYGYASYYPSVTPVQPPPPPPPAGADPSQS 562 Score = 29.1 bits (62), Expect = 6.5 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 7/68 (10%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGG----GXXGGPPPXPPPXXXGGPXFXPXXR---XVIPPSRG 47 PPPP PPPP G PPP P P P V PPS G Sbjct: 447 PPPPGSSMYNPPPPAPGQATPPPYGVQYAPPPAPIPPPGTAPSTDGAQNYPPGVTPPSSG 506 Query: 46 LKLTAXPS 23 P+ Sbjct: 507 APTQPVPA 514 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP PPPP G PPP PP Sbjct: 363 PPPPPPPPPRPPPPPPPI---KKGAPPPAPP 390 Score = 29.9 bits (64), Expect = 3.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PP G P P Sbjct: 353 PPPPPPPPPPPPPPPPP-----PPRPPPPPPPIKKGAPPPAP 389 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP +PP P PPP P P P P PP+ G Sbjct: 78 PPPPPTADPSPPLPHDNRTPQPRAAPPPAPAPDQP-APPSPPPSLPPSPPAPG 129 >01_01_0796 + 6190931-6192745 Length = 604 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPP PPPP GG P PPP G P Sbjct: 229 PPPFVADQPPPPPPPAAGGSLW--IPELPPPPVEGSP 263 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP PPPP GG P PPP G P Sbjct: 229 PPPFVADQPPPPPP--PAAGGSLWIPELPPPPVEGSP 263 >09_04_0616 + 18977421-18977907,18977984-18978245,18978903-18979149 Length = 331 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGA 179 PP GGG GGG PP GGGGA Sbjct: 272 PPAYRGGGGGGG--GSRPPIYYNGGGGA 297 >09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415, 2439856-2440214 Length = 398 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPP-----XPPPXXXGGPXF 86 PPPP P G G GG PP PPP G P F Sbjct: 314 PPPPPSAYQGNNPGYQGGGPGYHGGNPPPYQAGNPPPYQAGNPVF 358 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 31.1 bits (67), Expect = 1.6 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PP P +P P G PPP PPP Sbjct: 317 PPMPRSRSASPSPSTSSSGSAGPPAPPPPPPP 348 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP P G GPP PPP Sbjct: 314 PPPPPMPRSRSASPSPSTSSSGSAGPPAPPPPP 346 Score = 30.3 bits (65), Expect = 2.8 Identities = 16/55 (29%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP-PXXGGPXFXPXXXEXNSPXXGP 45 PP P P P G G PPP PP P ++P GP Sbjct: 317 PPMPRSRSASPSPSTSSSGSAGPPAPPPPPPPAAKRTSRTSTPATTSSSAPASGP 371 >05_07_0102 + 27700395-27700426,27701034-27702087,27703205-27703420 Length = 433 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 114 GGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 GG GGGP GGGG P GGG Sbjct: 18 GGGGGGPRGCGGGGPRSGGGGGPRGGGGGG 47 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP G PPP PP G P Sbjct: 41 PPPPG---AYPPPPGAYPPPPGAYPPPPGAYPPQHGYP 75 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 5/59 (8%) Frame = -3 Query: 206 PPPPXXXXGXPPPP-----XXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP P P P P P P Sbjct: 365 PPPPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPPLLAPKQQSSGGPILPP 423 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP G PPP Sbjct: 370 PPPPPPPPPAVTQQQDVKTSCGPAVPPP 397 Score = 29.5 bits (63), Expect = 4.9 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGP--PPXXPPPXXGGPXFXP 81 PPP PPPP GGP PP PP P F P Sbjct: 395 PPPPPPTPPPPPPLLAPKQQSSGGPILPPAPAPP----PLFRP 433 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGP--PPXPPP 110 PPP PPPP GGP PP P P Sbjct: 395 PPPPPPTPPPPPPLLAPKQQSSGGPILPPAPAP 427 >02_01_0584 - 4326072-4326094,4326306-4326885 Length = 200 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 79 GGGGGGGQDGGEESRDGGGGGGGEKGSGGGGG 110 >01_05_0513 - 22864657-22867899 Length = 1080 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 176 PPPPXXXX--GGGGXGGPPPXXPP 111 PPPP GGGG PPP PP Sbjct: 164 PPPPEDRPPEGGGGDNAPPPEVPP 187 Score = 29.5 bits (63), Expect = 4.9 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = -1 Query: 178 APPPPXXXX--GGGXXGGPPPXPPP 110 APPPP GGG PPP PP Sbjct: 163 APPPPEDRPPEGGGGDNAPPPEVPP 187 >01_01_0987 + 7803281-7803910,7803989-7804510 Length = 383 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +3 Query: 111 GGGXGGGPPXXP-PPXXXXGGGGAP 182 GGG GG PP P P GGGG P Sbjct: 40 GGGGGGRPPMLPRSPSTVSGGGGRP 64 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +1 Query: 109 GGGXXGGGPPX-PPPPXXXXGGGGXP 183 GGG GG PP P P GGGG P Sbjct: 39 GGGGGGGRPPMLPRSPSTVSGGGGRP 64 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = -1 Query: 205 PPPPXXXXGAPP----PPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP PP PP G PPP PPP G Sbjct: 27 PPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPPVGPPG 67 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = -3 Query: 206 PPPPXXXXGXPPP----PXXXXGGGGXGGPPPXXPPP 108 PPPP PPP P G PPP PPP Sbjct: 26 PPPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPP 62 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP APP G PPP PPP G P Sbjct: 33 PPPPPPLEPAPPSTPQLRG---EASPPP-PPPPPVGPP 66 >08_02_1410 - 26876243-26876497,26877129-26877239,26877240-26877324, 26877620-26877672,26878318-26878440,26878514-26878597, 26878708-26878773,26879512-26879584,26879854-26879888, 26879970-26880212 Length = 375 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 99 PXXXGGGXGGGPPXXPPPXXXXGGGG 176 P GGG GGG P P GGGG Sbjct: 13 PVVEGGGGGGGEGLNPNPSGGGGGGG 38 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSR 50 PPP P P G PPP PP G P P PP + Sbjct: 37 PPPQPYCQQQQPLPPHYYQAGPPHAPPPQQPPAMWGQPPPPPPQYAPPPPQQ 88 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXP 116 PPP GAPPPP G PPP P Sbjct: 17 PPPPQVSGAPPPPH----GHYQQQPPPQP 41 >06_03_1274 + 28897491-28897707,28897804-28897935,28898029-28898096, 28898216-28898280,28898468-28898534,28898630-28898917, 28898995-28899102,28899236-28899487,28899918-28899997, 28900092-28900185,28900728-28900810,28901319-28901873, 28902085-28902616 Length = 846 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 691 GGGGGXGXGGXXPPPP 644 G GGG G GG PPPP Sbjct: 32 GAGGGGGGGGAVPPPP 47 >02_02_0307 - 8809724-8811589,8811681-8811762,8812130-8812242, 8812361-8812492,8812681-8812864,8813002-8813135, 8813552-8813656,8813738-8813839,8813930-8814022, 8814136-8814456,8814595-8814696,8814791-8814853, 8815213-8815708,8815964-8816124,8816213-8816743, 8817077-8817118,8817203-8817334,8817639-8817703, 8817858-8818169,8818262-8818334,8818425-8818517, 8819440-8819501,8819740-8819809 Length = 1777 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXG-----GPPPXXPPPXXG 99 PPPP P GGGG G G P PPP G Sbjct: 147 PPPPASPDAAKTPGSPAGGGGGVGAGGGGGEEPMYPPPKLG 187 >06_03_0729 + 23927656-23927661,23927774-23927923,23928316-23928567, 23929072-23929209,23931213-23932730 Length = 687 Score = 25.4 bits (53), Expect(2) = 2.5 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 236 PPPPPPPXXXXXXXXFXXGGGG 301 PPPPPP GGGG Sbjct: 215 PPPPPPSPAAHRRCSSSGGGGG 236 Score = 23.4 bits (48), Expect(2) = 2.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 233 PPPPPPPP 256 PPPP PPP Sbjct: 210 PPPPSPPP 217 >05_05_0175 + 22966151-22967614 Length = 487 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 135 PXXPPPXXXXGGGGAP 182 P PPP GGGG+P Sbjct: 143 PPRPPPGRGGGGGGSP 158 Score = 25.4 bits (53), Expect(2) = 9.6 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = -1 Query: 181 GAPPPPXXXXGGGXXGGPPPXPP 113 G P GGG G PP PP Sbjct: 87 GTPRSAARCGGGGSPGAPPSSPP 109 Score = 24.6 bits (51), Expect(2) = 7.4 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 136 PXPPPPXXXXGGGGXP 183 P PPP GGGG P Sbjct: 143 PPRPPPGRGGGGGGSP 158 Score = 23.0 bits (47), Expect(2) = 2.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 111 GGGXGGGPPXXPP 149 GGG G PP PP Sbjct: 97 GGGSPGAPPSSPP 109 Score = 22.6 bits (46), Expect(2) = 7.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 109 GGGXXGGGPPXPPP 150 GGG G PP PP Sbjct: 96 GGGGSPGAPPSSPP 109 Score = 21.4 bits (43), Expect(2) = 9.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -1 Query: 127 PPXPPPXXXGG 95 PP PPP GG Sbjct: 143 PPRPPPGRGGG 153 >11_06_0561 - 24984960-24985205,24985283-24985354,24985906-24985977, 24986612-24986782,24987464-24987653,24987733-24987976, 24988162-24988474,24988687-24989517,24989628-24989672, 24989677-24989790,24989877-24990371,24990627-24990824, 24990902-24991357 Length = 1148 Score = 30.3 bits (65), Expect = 2.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +1 Query: 109 GGGXXGGGPPX----PPPPXXXXGGGGXPXXXXGGGG 207 GGG GG P PPP GGG GGGG Sbjct: 48 GGGADGGSPAPRAASPPPTAAGGQGGGGGGPVSGGGG 84 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 P PP P PP GGGG PP PPP Sbjct: 729 PSPPEYA---PEPPPGPPGGGGGYLPPVVFPPP 758 Score = 28.7 bits (61), Expect = 8.6 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 205 PPPPXXXXGAP-PPPXXXXGGGXXGGPPPXPPPXXXGGP 92 P PP AP PPP GGG P PPP GP Sbjct: 729 PSPPEY---APEPPPGPPGGGGGYLPPVVFPPPYASRGP 764 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 30.3 bits (65), Expect = 2.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 P P APPPP PPP PPP Sbjct: 63 PHPHHHVSAAPPPPQTPPSPPPPPPPPPPPPP 94 Score = 29.1 bits (62), Expect = 6.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP PPP PPP P Sbjct: 73 PPPPQTPPSPPPPPP----------PPPPPPPPLSPTP 100 >08_02_1329 - 26182762-26183007,26183149-26183249,26183533-26183602, 26183692-26183895,26186435-26186941,26188672-26188677 Length = 377 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPP 313 PPPPPP P GGG PP Sbjct: 84 PPPPPPAPYAGGSPYHRHAAGGGETPP 110 Score = 29.9 bits (64), Expect = 3.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -1 Query: 178 APPPPXXXXGGGXXGGPPPXPPPXXXGGPXF 86 APPPP PPP PP GG + Sbjct: 68 APPPPPSHHERAPSDAPPPPPPAPYAGGSPY 98 >06_03_0082 + 16363742-16364632 Length = 296 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP G PPP Sbjct: 169 PPPPPPPPFPDDSDGGDGASGEDLEPPP 196 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 612 CXXGXXXGGXXGGGGXXPPXPXPPPP 689 C GG GGG P P PPPP Sbjct: 151 CCCCCCGGGDQFGGGEERPPPPPPPP 176 Score = 28.7 bits (61), Expect = 8.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 612 CXXGXXXGGXXGGGGXXPPXPXPPPPP 692 C G GGG PP P PPP P Sbjct: 152 CCCCCGGGDQFGGGEERPPPPPPPPFP 178 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 691 GGGGGXGXGGXXPPPPXXPP 632 GGG G G PPPP PP Sbjct: 157 GGGDQFGGGEERPPPPPPPP 176 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 30.3 bits (65), Expect = 2.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPPXXPK 555 PP P PPP K K PPPP K Sbjct: 61 PPQPAKEPPPPTKPKHPKPKQQQHPPPPPPQK 92 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXG--GGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP P P P F PP Sbjct: 89 PPPPPPLLPTPPPPPASISPTPAPPLPPPPAPAPPPTPTPKFPSSSANPSPP 140 Score = 29.9 bits (64), Expect = 3.7 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF-XPXXXEXNSPXXGPXAYSX 30 PPPP PPPP PP PPP P P ++ P AY Sbjct: 89 PPPPPPLLPTPPPPPASI---SPTPAPPLPPPPAPAPPPTPTPKFPSSSANPSPPDAYPF 145 Query: 29 T 27 T Sbjct: 146 T 146 >04_03_1022 - 21778315-21779007 Length = 230 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/48 (35%), Positives = 20/48 (41%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTA 32 P P GG G PP PPP P + P PPSR + + A Sbjct: 98 PAPAPSTTPGGHGGVPPYYPPPPVTPTPYYYPSPAPP-PPSRHVVVIA 144 Score = 28.7 bits (61), Expect = 8.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 P P P P GG GG PP PPP Sbjct: 87 PHHPHHHHPPTPAPAPSTTPGGHGGVPPYYPPP 119 >04_01_0034 - 401208-402923 Length = 571 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSR 50 P P APPPP PPP PPP P R PP++ Sbjct: 297 PRLPLQPRPAPPPPPPQQQRAKPSRPPPPPPP-------LDPPPRAAAPPAK 341 >02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 Length = 794 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 8/31 (25%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGP--------PPXXPPP 108 PPPP GGGG G P PP PPP Sbjct: 14 PPPPPFGRGGGGAGYPRGHKQLYAPPPPPPP 44 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -1 Query: 181 GAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 G PP G G G P P PPP G P + P G Sbjct: 70 GVLPPSSLQRGVGAWGAPSPPPPPAAAGAAPHPPQQQREDPAFYG 114 Score = 28.7 bits (61), Expect = 8.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPP 313 PPPPPPPP F GGGG P Sbjct: 11 PPPPPPPP--------FGRGGGGAGYP 29 Score = 28.7 bits (61), Expect = 8.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 133 PPXPPPPXXXXGGGG 177 PP PPPP GGGG Sbjct: 11 PPPPPPPPFGRGGGG 25 >02_04_0177 + 20669053-20669055,20669150-20669198,20669680-20669962, 20670526-20670661,20671014-20671094 Length = 183 Score = 30.3 bits (65), Expect = 2.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G P GG GG P P GG P GGGG Sbjct: 132 GGPRGAPGDFGGEKGGAPAEFQP--SFRSSGGRPGFGRGGGG 171 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G P GG GG P P GG P GGGG Sbjct: 132 GGPRGAPGDFGGEKGGAPAEFQP--SFRSSGGRPGFGRGGGG 171 >09_04_0011 + 13703564-13703766,13704685-13705526,13705628-13705704, 13706294-13706339,13706479-13706722,13710078-13710150, 13711119-13711235 Length = 533 Score = 24.6 bits (51), Expect(2) = 3.4 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 176 PPPPXXXXGGGGXGG 132 PPP GGGG GG Sbjct: 113 PPPAQAAGGGGGGGG 127 Score = 23.8 bits (49), Expect(2) = 3.4 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = -3 Query: 152 GGGGXGGPPPXXPPPXXGGPXFXP 81 GGG PPP P GP P Sbjct: 167 GGGASAPPPPIRGIPIYNGPGGFP 190 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/43 (32%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP-PXXXGGPXFXP 80 PPPP PP P P P PP P G + P Sbjct: 265 PPPPPPPPPPPPMPPRTDNASTQAAPAPPPPLPRAGNGSGWLP 307 >09_04_0684 - 19442335-19442990,19443774-19443839,19443935-19444032, 19444787-19445157 Length = 396 Score = 29.9 bits (64), Expect = 3.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G GPP G G P PPPP G P GG G Sbjct: 304 GYQGGPPGYQGSNQGYQGPPPPPPSAYQGNN--PGYQGGGPG 343 Score = 29.1 bits (62), Expect = 6.5 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP P G G GG PPP G P + P Sbjct: 323 PPPPPSAYQGNNPGYQGGGPGYQGG---NPPPYQGGNPGYAP 361 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 29.9 bits (64), Expect = 3.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP 125 PPPP APPPP G PP Sbjct: 140 PPPPHVPKAAPPPPPPPPPHAPPGPPP 166 >07_03_1713 + 28939446-28939574,28939674-28940231,28940338-28940460, 28940676-28940912 Length = 348 Score = 29.9 bits (64), Expect = 3.7 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP---PXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPP PPPP G G P P PPP P + P G Sbjct: 128 PPPAYGHQAYPPPPPNREPGHGYHPAPAFYPPQPPPSHDEPGYGYRPPPVGPPGAG 183 >04_04_1401 + 33279092-33279286,33280223-33280306,33280459-33280524, 33280945-33281028,33281181-33281246,33281719-33281802, 33281955-33282020,33282323-33282388,33282667-33282726, 33282805-33282888,33282968-33283111,33283552-33283586, 33283694-33283746,33283828-33283928,33284516-33284974 Length = 548 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 636 GXXGGGGXXPPXPXPPPPP 692 G GGGG P P PP PP Sbjct: 24 GNGGGGGSPPSSPSPPSPP 42 >04_04_1182 + 31531426-31531702,31533741-31533997,31534672-31534818, 31535974-31536111 Length = 272 Score = 29.9 bits (64), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +1 Query: 94 GPPXXGGGXXGGG-PPXPPPP 153 GP GGG G G PP PPPP Sbjct: 49 GPGGGGGGGGGMGIPPRPPPP 69 >04_04_1104 - 30928475-30928501,30929008-30929110,30929287-30929340, 30929803-30929895,30930063-30930140,30930416-30930527, 30930618-30930756,30930823-30930910,30930984-30931079, 30931675-30931781,30931874-30932009,30932089-30932186, 30932954-30933047,30933132-30933301,30933749-30933819, 30936066-30936194,30936552-30936654,30936764-30936907, 30937123-30937245,30937482-30937563,30939044-30939120, 30939261-30939315,30939365-30939443,30939544-30939620, 30939739-30939869,30939947-30940120,30940245-30940310, 30940937-30941572 Length = 1113 Score = 29.9 bits (64), Expect = 3.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPP 123 P P PPP GGGG PPP Sbjct: 65 PAPPAPAAPPPPTSRRGGGGGAALPPP 91 >04_04_0183 - 23384290-23384783,23385064-23385139,23385291-23385296 Length = 191 Score = 29.9 bits (64), Expect = 3.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGG 132 PP P G PPP GGGG G Sbjct: 97 PPAPYYGNGGYPPPHQRGGGGGGSG 121 Score = 28.7 bits (61), Expect = 8.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGG 132 P P G PPP GGGG GG Sbjct: 98 PAPYYGNGGYPPPHQRGGGGGGSGG 122 >04_01_0162 + 1845295-1846317,1846430-1846565,1848436-1848626, 1848780-1848887,1849001-1849204,1849294-1849525, 1849602-1849751,1849830-1850007,1850416-1850519, 1850611-1850933,1851274-1851459,1851672-1851899 Length = 1020 Score = 29.9 bits (64), Expect = 3.7 Identities = 18/59 (30%), Positives = 21/59 (35%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PP G PPP G PPP P P +PPS+G +A P Sbjct: 118 PPSQGPFGTAPPPSQ---GPFGTAPPPSQGPFGTAPPPSQGPFAASVPPSQGPFASAQP 173 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 29.9 bits (64), Expect = 3.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 45 GGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSGGGG 86 Score = 29.5 bits (63), Expect = 4.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 44 GGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGG 75 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 45 GGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSGGGG 86 >03_06_0144 - 31969609-31969866,31969961-31970371,31970472-31970542, 31970637-31970723,31970816-31971389 Length = 466 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 636 GXXGGGGXXPPXPXPPPPP 692 G GGGG P PPPPP Sbjct: 52 GSKGGGGRDTSGPKPPPPP 70 >03_01_0023 + 198414-198968 Length = 184 Score = 29.9 bits (64), Expect = 3.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 56 GGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGG 97 Score = 28.7 bits (61), Expect = 8.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GG GGG GGGG GGGG Sbjct: 56 GGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGG 97 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 29.9 bits (64), Expect = 3.7 Identities = 21/60 (35%), Positives = 22/60 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPP PPP PPP G F P P GL + A P Sbjct: 430 PPPPPEHP--PPPESTSPPPPPTSDPPPVPPPPPTTG-SFMPIPS---APFAGLPVPAGP 483 >01_05_0490 + 22672241-22674679 Length = 812 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGG 295 PPPPPPPP F GG Sbjct: 607 PPPPPPPPPSSIFYNLFKKGG 627 >01_01_0082 + 625198-625719 Length = 173 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPP PPPP GGGG P P P Sbjct: 84 PPPTTPSTNCPPPP---YGGGGYNPTPSYNPTP 113 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 29.5 bits (63), Expect = 4.9 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 PPP P PP PPP PPP P + Sbjct: 21 PPPSSSSPSPPVPPDPYGADLSPPPPPPPKPPPTVPPPSY 60 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/40 (35%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXP-PPXXXGGPXF 86 PPP +PP P G PPP P PP P + Sbjct: 21 PPPSSSSPSPPVPPDPYGADLSPPPPPPPKPPPTVPPPSY 60 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPP PPPP PP PP P P ++PPS Sbjct: 70 PPPAIVPPALPPPPPLPA----IVVPPALPPTPAIAVPPALPPIPAIVPPS 116 >08_02_0864 + 21994286-21994989,21996257-21996958,21997221-21997374, 21997494-21997838,21998323-21999240,21999312-21999640, 21999709-21999832,21999901-22000071,22000188-22001648, 22002647-22002910,22003866-22004189 Length = 1831 Score = 29.5 bits (63), Expect = 4.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP 114 PPPP PPPP G GG GG P Sbjct: 28 PPPPL-----PPPPASQVGAGGGGGAASPQP 53 >08_02_0602 + 19183549-19184919 Length = 456 Score = 29.5 bits (63), Expect = 4.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 PP G G G G GGGG GGGG Sbjct: 45 PPHSSGSGSGSGGSHRGASGGGSGGGGGGGGGGGGGG 81 >08_02_0039 - 11512553-11512822,11512920-11513171,11513784-11513951, 11519429-11519622,11519774-11519795,11519928-11520239, 11520497-11520826,11520855-11521069,11523106-11523151, 11523207-11523290 Length = 630 Score = 29.5 bits (63), Expect = 4.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 127 GGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G PP PP P GGG P GG Sbjct: 8 GSPPFPPSPLALFSGGGVPGRGRRRGG 34 >06_01_0254 + 1898586-1899617 Length = 343 Score = 29.5 bits (63), Expect = 4.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 621 GXXXGGXXGGGGXXPPXPXPPPPP 692 G GG GG PP PPPPP Sbjct: 70 GDDDGGGGGGKIALPPFTQPPPPP 93 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 29.5 bits (63), Expect = 4.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPP PPPP G PPP PPP Sbjct: 1926 PPPHAPPPPPPPPPVE----GKPKPPPHAPPP 1953 Score = 29.5 bits (63), Expect = 4.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPPXXPKK 552 P P PPP K K PPPP KK Sbjct: 1928 PHAPPPPPPPPPVEGKPKPPPHAPPPPPPEAKK 1960 >04_03_0977 + 21381857-21383757,21384299-21384458,21384669-21384717, 21385117-21385169 Length = 720 Score = 29.5 bits (63), Expect = 4.9 Identities = 12/18 (66%), Positives = 12/18 (66%), Gaps = 2/18 (11%) Frame = +3 Query: 645 GGGGXX--PPXPXPPPPP 692 GGGG PP P PPPPP Sbjct: 93 GGGGWVQLPPPPPPPPPP 110 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 636 GXXGGGGXXPPXPXPPPPP 692 G GGG P P PPPPP Sbjct: 91 GVGGGGWVQLPPPPPPPPP 109 >03_05_1081 + 30235677-30236474 Length = 265 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP APPPP G P PPP P P Sbjct: 40 PPPPSAYPAAPPPPVM--------GQPVPPPPAQLHDPTAPP 73 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 29.5 bits (63), Expect = 4.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 147 GGGGGGGGGGGGGDVGGDGGGGGDGNVGGGGG 178 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 87 KXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 K G GGG GGG GGGG GGGG Sbjct: 30 KQGCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 69 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 78 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 79 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 80 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 81 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 82 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 83 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 84 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 85 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 86 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 47 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 32 GCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 73 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 78 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 79 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 80 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 81 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 82 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 83 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 84 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 85 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 86 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 47 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 >02_04_0001 - 18816492-18816741,18816881-18817050,18817244-18817388, 18817495-18817565,18817910-18817993,18818103-18818222, 18818310-18818480,18818955-18819044,18821893-18821985, 18822073-18822405 Length = 508 Score = 29.5 bits (63), Expect = 4.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 645 GGGGXXPPXPXPPPPP 692 G G PP P PPPPP Sbjct: 41 GAGDVSPPSPPPPPPP 56 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPP P P PPP P P P P Sbjct: 112 PPPPRKKPQFQPPPQPPRA----WDPSPPPPPPAPAAPVLVPPPAPAPRPAPAP 161 >05_01_0131 + 888247-888771,889092-889154 Length = 195 Score = 23.8 bits (49), Expect(2) = 6.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 233 PPPPPPP 253 PPPPPPP Sbjct: 133 PPPPPPP 139 Score = 23.8 bits (49), Expect(2) = 6.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 236 PPPPPPP 256 PPPPPPP Sbjct: 160 PPPPPPP 166 >01_05_0319 - 20871781-20871909,20872001-20872053,20873271-20873598 Length = 169 Score = 24.6 bits (51), Expect(2) = 6.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 316 GGGGXPPPP 290 GGGG PPPP Sbjct: 10 GGGGTPPPP 18 Score = 23.0 bits (47), Expect(2) = 6.3 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = -1 Query: 181 GAPPPPXXXXGGGXXGGP 128 G PPPP G G P Sbjct: 13 GTPPPPTGAGSGSRAGAP 30 >12_02_1007 - 25248653-25249078,25249956-25250021,25250108-25250260, 25250961-25251336,25252001-25252143 Length = 387 Score = 29.1 bits (62), Expect = 6.5 Identities = 18/63 (28%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXG-GPPPXPPPXXXGGP--XFXPXXRXVIPPSRGLKLT 35 PPPP P P G PPP PP G + P ++PP L Sbjct: 293 PPPPPPPVTMPMHPGMVLAAPPPGAAPPPGPPAMVPFGAMLPYPPYPAVLLPPPAAATLY 352 Query: 34 AXP 26 P Sbjct: 353 GRP 355 >12_02_0998 + 25126114-25126596,25129213-25129339,25129349-25129459, 25130122-25130270,25130356-25130643,25130753-25130941, 25131445-25131619,25132219-25132316 Length = 539 Score = 29.1 bits (62), Expect = 6.5 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = -3 Query: 206 PPPPXXXXGXPP----PPXXXXGGGGXGGPPPXXPP 111 P PP G PP P GG G GG P PP Sbjct: 301 PMPPPQTWGPPPPWGHPSNVPPGGPGYGGNPQFMPP 336 >12_02_0848 + 23636478-23638058 Length = 526 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP PPP PPP G P Sbjct: 64 PPPPPIIDASPPPPST--------SPPP--PPPRRGRP 91 >10_08_0521 + 18500105-18500529,18501216-18501284,18501467-18501555, 18501726-18501838,18502023-18502124,18502576-18502663, 18502795-18503361,18503766-18504149,18504168-18504384, 18504466-18504548,18505174-18505256,18505796-18506032, 18506481-18506658,18506814-18507328,18507740-18507916, 18508385-18508768,18508885-18509031 Length = 1285 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GG GGG GGGGA GGGG Sbjct: 66 GVGGGEAMEVDGGAGGGGGGVGDVEGGGGGGGAGGGGGGGGG 107 >10_08_0451 + 18033065-18033253,18033746-18033805,18034256-18034324, 18034751-18034786,18035081-18035146,18035345-18035443, 18035543-18035620,18035724-18035802,18035999-18036093, 18036251-18036335,18036505-18036698,18036804-18036922, 18037015-18037057 Length = 403 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 636 GXXGGGGXXPPXPXPPPPP 692 G GGGG P PPPPP Sbjct: 22 GGGGGGGMGSPPLGPPPPP 40 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 633 GGXXGGGGXXPPXPXPPPP 689 GG GGG PP PPPP Sbjct: 22 GGGGGGGMGSPPLGPPPPP 40 >10_08_0115 + 14924463-14924939 Length = 158 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 178 APPPPXXXXGGGXXGGPPPXPPP 110 A PPP G PPP PPP Sbjct: 89 ATPPPEDVAGDDMIDAPPPPPPP 111 >08_02_1258 - 25670092-25670152,25671124-25671327,25671400-25671611, 25671701-25671749,25671833-25672612,25672696-25672767, 25672907-25672954,25673053-25673127,25673238-25673312, 25673614-25673668,25673931-25674016,25674759-25674988 Length = 648 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPP----XXPPPXXGGP 93 PPP G P P GG GGP P PPP P Sbjct: 584 PPPFEPTGGPRPRRPGRGGLPMGGPSPILAAPLPPPHMHDP 624 >08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384, 7484473-7484603,7484726-7484802,7484981-7485064, 7487885-7488066,7488189-7488266,7489813-7489945, 7491610-7491670,7491861-7491942,7492143-7492271, 7492510-7492653,7493102-7493204,7493382-7493513, 7494127-7494485,7495149-7495229,7495384-7495450, 7495636-7495706,7496087-7496178,7496365-7496458, 7497692-7497789,7498206-7498341,7498599-7498618, 7498781-7498876,7498973-7499060,7499171-7499288, 7499738-7499759,7500203-7500326,7500625-7500702, 7500837-7500955,7501816-7501869,7502260-7502362, 7503133-7503261,7503345-7503453,7503788-7503819 Length = 1424 Score = 29.1 bits (62), Expect = 6.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 648 GGGXXPPXPXPPPPP 692 G G PP P PPPPP Sbjct: 150 GPGFAPPLPLPPPPP 164 >08_01_0619 + 5412058-5413224,5413357-5413476,5413755-5413831, 5414201-5414321 Length = 494 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 236 PPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPP PP GGGG P P Sbjct: 258 PPPPQPPVPMPMQAPPRIGGGGRRPKP 284 >08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180, 5263263-5263312,5265266-5265725,5266349-5266708 Length = 434 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP G PPP P P G P Sbjct: 38 PPPPQMWGQAPPPPPQMWG----QAPPP--PQPAYGQP 69 Score = 28.7 bits (61), Expect = 8.6 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPP---XXPPP 108 PPPP G G GG PP PPP Sbjct: 3 PPPPPPQAGVAGGGGAPPQWGAIPPP 28 Score = 28.7 bits (61), Expect = 8.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP G PPP G G PP P G Sbjct: 59 PPPPQPAYGQPPPAQ----AGYYGAPPQAAPAVPAG 90 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP PPP PPP Sbjct: 425 PPPPPLPP-PPPPPPPPPPPLPPNMPPPLPPPP 456 >08_01_0207 - 1647168-1647251,1647583-1647726,1648176-1648287, 1648392-1648573,1648649-1648780,1648900-1649856, 1649949-1650734 Length = 798 Score = 29.1 bits (62), Expect = 6.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 636 GXXGGGGXXPPXPXPPPPP 692 G G PP P PPPPP Sbjct: 499 GPSNGSAANPPKPPPPPPP 517 >07_03_1751 - 29215074-29216270 Length = 398 Score = 29.1 bits (62), Expect = 6.5 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 57 GGITFLXXGXKXGPPXXXGGGXGGGPPXXPPPXXXXG-GGGAPXXXXGGGG 206 GG L G G GGG GGG G GGGA GGGG Sbjct: 164 GGGGGLGGGAGGGAGGGLGGGSGGGGGLGGGAGGGAGVGGGAGGGAGGGGG 214 >07_03_0965 - 22996575-22999112,22999202-22999636,22999717-22999801, 22999888-22999957,23000050-23000293,23000396-23000482, 23000655-23000706,23000830-23001226,23001324-23001648, 23001748-23001914,23002007-23002547 Length = 1646 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 GGG GGGPP PP GG GG Sbjct: 15 GGGGGGGPP--PPRRRLRSSGGGGGGSGSGG 43 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 112 GGXXGGGPPXPPPPXXXXGGGG 177 GG GGGPP P GGGG Sbjct: 15 GGGGGGGPPPPRRRLRSSGGGG 36 >06_03_1326 - 29355467-29355817 Length = 116 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G K G G G GGG GGGG GGGG Sbjct: 2 GGKGGGGGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGG 43 >06_03_0790 - 24636805-24637770 Length = 321 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 125 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 126 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 127 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 128 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 129 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 135 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 136 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 101 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 103 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 104 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 78 GVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119 Score = 28.7 bits (61), Expect = 8.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113 Score = 28.7 bits (61), Expect = 8.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 125 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 126 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 127 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 128 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 129 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 130 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 135 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 136 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 101 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 103 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 104 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 >06_03_0647 + 23122074-23122187,23123423-23123488,23124467-23124676, 23124849-23125060,23125641-23126208 Length = 389 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 691 GGGGGXGXGGXXPPPP 644 GGGGG G GG PP P Sbjct: 7 GGGGGGGGGGGRPPIP 22 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 167 GGGGXPXXXXXXXXXXXXXXXXPPPPPPPP 256 GGGG PPPPPPPP Sbjct: 120 GGGGFDALYRAPIGPYVRGATAPPPPPPPP 149 >03_06_0348 - 33299824-33300234 Length = 136 Score = 29.1 bits (62), Expect = 6.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 114 GGXGGGPPXXPPPXXXXG-GGGAPXXXXGGGG 206 GG GGG P G GGG P GGGG Sbjct: 99 GGVGGGMGSVGPVGGFGGAGGGTPFGGFGGGG 130 >03_02_0131 - 5796564-5796605,5797188-5797421,5798415-5798717, 5799260-5799847,5800594-5800749,5800861-5800919, 5801935-5802262 Length = 569 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGG 132 PPPP G P GGGG GG Sbjct: 35 PPPPLALQGVVTPGAGRRGGGGGGG 59 >03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021, 5103670-5104577 Length = 538 Score = 29.1 bits (62), Expect = 6.5 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 6/51 (11%) Frame = -1 Query: 205 PPPPXXXXG------APPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXR 71 PPPP G APPP P P PPP P P R Sbjct: 186 PPPPADEDGTSASAGAPPPQAPLPPPAPVPAPAPPPPPAAAPAPAAQPEQR 236 >01_06_1104 - 34551466-34551572,34552019-34553057 Length = 381 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 115 GXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 G G G PPPP GGGG GG Sbjct: 57 GPSGPGGRLPPPPRSYGGGGGSGDAADSGG 86 >01_06_1007 - 33733500-33733604,33733837-33733917,33734191-33734238, 33734364-33734549,33735148-33735678,33735823-33735864, 33735945-33736065,33736200-33736281,33737169-33737227, 33738492-33738564,33738694-33738913 Length = 515 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 691 GGGGGXGXGGXXPPPP 644 GGGGG G GG P PP Sbjct: 36 GGGGGGGSGGGVPLPP 51 >01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536, 7878507-7878761 Length = 223 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 691 GGGGGXGXGGXXPPPPXXPPXXXP 620 GGGGG G G PP PP P Sbjct: 20 GGGGGGGEYGTFQGPPSYPPPRPP 43 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 25.8 bits (54), Expect(2) = 6.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 663 PPXPXPPPPP 692 PP P PPPPP Sbjct: 1160 PPPPLPPPPP 1169 Score = 21.4 bits (43), Expect(2) = 6.8 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +3 Query: 636 GXXGGGGXXPPXPXPPPP 689 G G P P PPPP Sbjct: 1146 GYAGHANQMPLPPPPPPP 1163 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 24.6 bits (51), Expect(2) = 6.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 651 GGXXPPXPXPPPP 689 G PP P PPPP Sbjct: 44 GSPPPPSPPPPPP 56 Score = 22.6 bits (46), Expect(2) = 6.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 663 PPXPXPPPPP 692 P P PPPPP Sbjct: 69 PTNPSPPPPP 78 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 24.2 bits (50), Expect(2) = 7.2 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +2 Query: 236 PPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPP PPP Sbjct: 119 PPPPPPPHPPEDPPPHPPHPPDHPPPP 145 Score = 23.0 bits (47), Expect(2) = 7.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 233 PPPPPPPP 256 PPPPPP P Sbjct: 84 PPPPPPVP 91 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 28.7 bits (61), Expect = 8.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPP PPP G Sbjct: 113 PPPPPHLLHYYGHPPPPPPPPPPFKG 138 Score = 24.6 bits (51), Expect(2) = 7.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 654 GXXPPXPXPPPP 689 G PP P PPPP Sbjct: 124 GHPPPPPPPPPP 135 Score = 22.6 bits (46), Expect(2) = 7.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 663 PPXPXPPPPP 692 P P PPPPP Sbjct: 165 PSHPSPPPPP 174 >12_01_0742 - 6656464-6656739 Length = 91 Score = 28.7 bits (61), Expect = 8.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPP G PPPP G P P PP Sbjct: 49 PPPPDSCGRPPPPLPLDRAEGR-APQPLLPP 78 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 28.7 bits (61), Expect = 8.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP PPPP P P P GG Sbjct: 150 PPPPQESTPPPPPPPPPAPVAAAVSAPAPPSPASQGG 186 >12_01_0252 + 1868670-1869200,1870167-1871120 Length = 494 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGG 301 PPPPPPPP G GG Sbjct: 63 PPPPPPPPLNWPTAGGGGGGSGG 85 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 28.7 bits (61), Expect = 8.6 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPP PPP P P P + P P Sbjct: 1168 PPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAP 1221 >11_06_0562 + 25003246-25003746,25004975-25005214,25005576-25006097, 25006184-25007248,25007350-25007656,25007761-25008001, 25008104-25008302,25008771-25008852,25008959-25009209, 25010061-25010219,25010220-25010603 Length = 1316 Score = 28.7 bits (61), Expect = 8.6 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 109 GGGXXGGGPPX--PPPPXXXXGGGGXPXXXXGGGG 207 GGG GG P PP GG G GGGG Sbjct: 49 GGGADGGSPASRAASPPTTAAGGQGGGGPVSGGGG 83 >11_01_0242 - 1862106-1862210,1862302-1862320,1863082-1863257, 1863359-1863405,1864443-1865022 Length = 308 Score = 28.7 bits (61), Expect = 8.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -3 Query: 182 GXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 G PP GGG G PP P GG Sbjct: 63 GAPPSTQPYGSGGGYGAPPSTQRPQSYGG 91 >10_08_1026 + 22400551-22401161,22401437-22401632,22401837-22401889, 22402369-22402819 Length = 436 Score = 28.7 bits (61), Expect = 8.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 P P A PP GG PPP PP Sbjct: 106 PEPQSTSAADPPTNDDEWGGDPAPPPPPPP 135 >10_07_0161 - 13674631-13675433,13675793-13675862 Length = 290 Score = 28.7 bits (61), Expect = 8.6 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 58 GELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G L G GGG GGG GGGG GGGG Sbjct: 175 GRSGGGLTDSGGGGGWTGGGNGGGGSGGGGGARGSSGGGGGGGWAGGGGG 224 >10_01_0129 + 1535823-1537196 Length = 457 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 Query: 152 GGGGXGGPPPXXPPPXXGGP 93 GGGG GG P PP G P Sbjct: 12 GGGGGGGGAPRGSPPGGGSP 31 >08_01_0394 - 3487360-3488229 Length = 289 Score = 28.7 bits (61), Expect = 8.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXG 99 P P GGGG GG PP P G Sbjct: 227 PAPAGSDQGGGGSGGMPPLGVDPSGG 252 >07_03_0177 - 14770777-14772045 Length = 422 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 58 GGGYGKGGGFGGGGGGGGGGGFGGGGGFGGGGGGGLGGGGGG 99 Score = 28.7 bits (61), Expect = 8.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 69 GGGGGGGGGGFGGGGGFGGGGGGGLGGGGGGG 100 >07_01_0378 + 2826421-2826427,2827286-2827375,2827400-2827639, 2827722-2828035,2828604-2828696,2828789-2828977 Length = 310 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -3 Query: 182 GXPPPPXXXXGGGGXGGPPPXXPP 111 G PP P G G GP P PP Sbjct: 33 GSPPKPWERAGAEGTSGPAPFKPP 56 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 28.7 bits (61), Expect = 8.6 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 6/38 (15%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGP------PPXPPP 110 PPPP APPPP G PP PPP Sbjct: 9 PPPPHSSYAAPPPPPPPPPGTSLYASYRHHAYPPHPPP 46 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP + PPP Sbjct: 19 PPPPPPPPPGTSLYASYRHHAYPPHPPP 46 >06_03_1172 - 28147957-28148274,28149362-28149877 Length = 277 Score = 28.7 bits (61), Expect = 8.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 145 GXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 G GG PP PPP F P + PP Sbjct: 5 GAGGGAPPPPPPSPPSVYPFLPPATFIPPP 34 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGG 298 PPPPPPPP GGG Sbjct: 31 PPPPPPPPPPSGAAAGEDNGGG 52 >05_03_0626 - 16335816-16335917,16336331-16336558,16336694-16336973, 16337596-16338560 Length = 524 Score = 28.7 bits (61), Expect = 8.6 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 612 CXXGXXXGGXXGGG-GXXPPXPXPPPPP 692 C G GG GGG PP P PPP Sbjct: 70 CVGGPDDGGGGGGGLAFLPPTIFPSPPP 97 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 636 GXXGGGGXXPPXPXPPPPP 692 G G G PP P PPPPP Sbjct: 542 GEEGLVGPPPPPPPPPPPP 560 >04_04_0057 + 22410167-22411330 Length = 387 Score = 28.7 bits (61), Expect = 8.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP A P PPP PPP Sbjct: 183 PPPPPPPAAAAASPSPERSPRCQPSPPPPPPP 214 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 28.7 bits (61), Expect = 8.6 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPP P P P P P P + PP Sbjct: 193 PPPPKEEEKPEPPPAVIIVEPPAPAPEPEPEPPKKEPPPPPPPKQEPCPP 242 >01_06_1293 - 36050847-36051304,36052343-36052826 Length = 313 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 691 GGGGGXGXGGXXPPPPXXPP 632 GGGGG G PP P PP Sbjct: 10 GGGGGRAGGFSDPPSPLSPP 29 >01_01_0130 + 1182504-1182817,1183024-1183152,1183582-1183716, 1184296-1184392,1184633-1184736,1184924-1184975, 1185261-1185458 Length = 342 Score = 28.7 bits (61), Expect = 8.6 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 109 GGGXXGGGPPXPP 147 GGG GGGPP PP Sbjct: 23 GGGGAGGGPPGPP 35 >06_01_0738 + 5458182-5458374,5460512-5461766,5461861-5462053, 5462151-5462344,5462443-5462601,5462683-5463025 Length = 778 Score = 25.4 bits (53), Expect(2) = 9.2 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGP 128 PPP G+ PP GG G P Sbjct: 90 PPPGNLAGSGTPPAKGSGGDGGGAP 114 Score = 21.4 bits (43), Expect(2) = 9.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -1 Query: 316 GGGGXPPPP 290 GGGG PPP Sbjct: 84 GGGGSAPPP 92 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,039,620 Number of Sequences: 37544 Number of extensions: 839429 Number of successful extensions: 26014 Number of sequences better than 10.0: 167 Number of HSP's better than 10.0 without gapping: 3115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18441 length of database: 14,793,348 effective HSP length: 83 effective length of database: 11,677,196 effective search space used: 3269614880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -