BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L01 (1093 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 45 9e-05 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 43 4e-04 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 42 0.001 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 41 0.002 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 40 0.004 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 38 0.014 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.033 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 37 0.033 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 37 0.033 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 36 0.043 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 36 0.043 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 36 0.057 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.076 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 35 0.13 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.17 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 34 0.23 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 33 0.31 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 33 0.40 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 32 0.71 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.71 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 32 0.71 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 32 0.71 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) 31 1.6 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.2 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 30 2.8 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 30 3.8 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 29 5.0 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 29 5.0 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 29 6.6 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 24 7.2 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 8.7 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 29 8.7 SB_45874| Best HMM Match : TIR (HMM E-Value=0.43) 29 8.7 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.7 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 29 8.7 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.0 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 45.2 bits (102), Expect = 9e-05 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 1/87 (1%) Frame = -1 Query: 310 GGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGG 131 G PPPP PPPP GAPPPP GG Sbjct: 303 GAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSR--GAPPPPSMGMAPPPVGG 360 Query: 130 P-PPXPPPXXXGGPXFXPXXRXVIPPS 53 PP PPP GGP P PPS Sbjct: 361 AAPPPPPPPPVGGPPPPPPPIEGRPPS 387 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG--GGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPPP G G PPP PPP G P P Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPP-PPPGRGAPPPGP 407 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGG--GXXGGPPPXPPPXXXGGP 92 PPPP G PPPP G G PPP PPP P Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 404 Score = 39.5 bits (88), Expect = 0.005 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG---GGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP G PPPP GG PPP PPP GGP P E P Sbjct: 338 PPPPSR--GAPPPPSMGMAPPPVGGAAPPPP--PPPPVGGPPPPPPPIEGRPP 386 Score = 34.7 bits (76), Expect = 0.13 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = -1 Query: 205 PPPPXXXXGAPPPP--XXXXGGGXXGGPPPXPPPXXXGGPXFXPXXR---XVIPPSRG 47 PPPP APPPP G PP PP P P R PPSRG Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRG 344 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP PPPP GG PP PP G P +P GP Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 29.9 bits (64), Expect = 3.8 Identities = 19/58 (32%), Positives = 21/58 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP G PP PPP G P +P P + S Sbjct: 287 PPPPPSRGAAPPPP-------SRGAPP---PPPSRGSAPPPPPARMGTAPPPPPPSRS 334 Score = 28.7 bits (61), Expect = 8.7 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP P PPP G P P P Sbjct: 316 PPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPP 369 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP PPPP GG PP PPP P P PP R L Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMRKL 998 Score = 39.5 bits (88), Expect = 0.005 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP GG PP PPP P P Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPP 986 Score = 34.7 bits (76), Expect = 0.13 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP----PPXXXGGPXFXPXXRXVIPP 56 PPPP + PPP GG PPP P PP G P P PP Sbjct: 934 PPPPGGSAPSQPPPP----GGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPP 983 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-----XXPPPXXGG 96 PPPP G P P GG PPP PPP GG Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGG 961 Score = 33.9 bits (74), Expect = 0.23 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXX---PPPXXGGPXFXPXXXEXNSPXXGP 45 PPP PPPP GG PPP PPP G P P P P Sbjct: 935 PPPGGSAPSQPPPP----GGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPP 987 Score = 32.3 bits (70), Expect = 0.71 Identities = 21/64 (32%), Positives = 23/64 (35%), Gaps = 10/64 (15%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG------GGXGGPPPXXP----PPXXGGPXFXPXXXEXNSP 57 PPPP PPPP GG PPP P PP GG P ++P Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAP 982 Query: 56 XXGP 45 P Sbjct: 983 PPPP 986 Score = 29.9 bits (64), Expect = 3.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 645 GGGGXXPPXPXPPPPP 692 GG PP P PPPPP Sbjct: 978 GGSAPPPPPPPPPPPP 993 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 43.2 bits (97), Expect = 4e-04 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 205 PPPPXXXXGAP-PPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP AP PPP GG PPP PPP GG Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGG 329 Score = 41.9 bits (94), Expect = 9e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP PPP GG PPP PPP GG Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGG 329 Score = 41.1 bits (92), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPP APPPP G PPP PPP G P P Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP G G PPP PPP Sbjct: 306 PPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP P PP GG PPP PPP G Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDG 328 Score = 35.1 bits (77), Expect = 0.10 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP PPPP G PPP PP G P P Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 30.7 bits (66), Expect = 2.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP GG PP PPPP G GG P Sbjct: 307 PPPPGGAP----PPPPPPPPPPPGDGGAP 331 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP G GG PPP Sbjct: 314 PPPPPPPPPPPP-------GDGGAPPPP 334 Score = 29.9 bits (64), Expect = 3.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPPXXP 558 PP P PPP G PPPP P Sbjct: 307 PPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 29.9 bits (64), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 648 GGGXXPPXPXPPPPP 692 GG PP P PPPPP Sbjct: 311 GGAPPPPPPPPPPPP 325 Score = 29.5 bits (63), Expect = 5.0 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 181 GAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 GAP PP G PPP PPP GG P PP G Sbjct: 288 GAPVPPPPPADGSAPA-PPPPPPP---GGAPPPPPPPPPPPPGDG 328 Score = 28.7 bits (61), Expect = 8.7 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAP 182 PP GG PP PPP G GGAP Sbjct: 306 PPPPPGGAPPPPPPPPPPP---PGDGGAP 331 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP GA PPP G GG PP PPP G + VI P Sbjct: 678 PPPPPLPGGAAPPPPPPIG----GGAPPPPPPGFGGFANLVKPRKGVIKP 723 Score = 39.9 bits (89), Expect = 0.004 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 181 GAPPPPXXXXGGGXXGGPPPXPPPXXXG-GPXFXPXXRXVIPP 56 G PPPP GG G PPP PPP G P P PP Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPP 701 Score = 39.5 bits (88), Expect = 0.005 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPP GAPPPP GG PPP PPP G P P Sbjct: 666 PPPGGQAGGAPPPPPPPLPGG--AAPPP-PPPIGGGAPPPPP 704 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G PP GG GG PP PPPP GG P GGG Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPPPP--LPGGAAPPPPPPIGGG 698 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPP GG G PPP PPP GG Sbjct: 678 PPPPPLPGGAAPPPPPPIGG---GAPPP--PPPGFGG 709 Score = 38.3 bits (85), Expect = 0.011 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = -3 Query: 182 GXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAY 36 G PPPP GG G PPP PP G P +P P + Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGF 707 Score = 36.3 bits (80), Expect = 0.043 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPP G PPPP GG PPP PPP GG Sbjct: 666 PPPGGQAGGAPPPPPPPLPGG--AAPPP--PPPIGGG 698 Score = 35.9 bits (79), Expect = 0.057 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G PP GG GG PP PPP GG P GGG Sbjct: 659 GPPPPPPPPPGGQAGGAPP--PPPPPLPGGAAPPPPPPIGGG 698 Score = 31.9 bits (69), Expect = 0.93 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPP P GGG PPP Sbjct: 677 PPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP G PPP PPP G Sbjct: 716 PPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAG 752 Score = 40.3 bits (90), Expect = 0.003 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP G PPPP G PPP PPP G Sbjct: 716 PPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAG 752 Score = 39.5 bits (88), Expect = 0.005 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP G PPP PPP G P P Sbjct: 717 PPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 Score = 38.7 bits (86), Expect = 0.008 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP G G PPP PP G P P Sbjct: 717 PPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 Score = 33.9 bits (74), Expect = 0.23 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP G PPP PPP G P P Sbjct: 694 PPPPP-----PPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP 730 Score = 33.9 bits (74), Expect = 0.23 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -1 Query: 205 PPPPXXXXGA----PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PPPP G PPP P P G P P Sbjct: 699 PPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPP 744 Score = 32.3 bits (70), Expect = 0.71 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -1 Query: 205 PPPPXXXXGAP--PPPXXXXGGGXXGGPPPXPPPXXXGGPXF 86 PPPP G PPP G G PPP PP P F Sbjct: 727 PPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKPLF 768 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP P PP G G PP P P G P Sbjct: 700 PPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPP 741 Score = 29.9 bits (64), Expect = 3.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPP 108 PPPP G PPP PPP Sbjct: 679 PPPPLPVIEGSSLSVPPPPPPPP 701 Score = 28.7 bits (61), Expect = 8.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -3 Query: 206 PPPPXXXXGXP--PPPXXXXGGGGXGGPPPXXPPP 108 PPPP G PPP G G PPP PPP Sbjct: 727 PPPPSPQPGCAGLPPPPPPPPPGCAGLPPP--PPP 759 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/90 (32%), Positives = 29/90 (32%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 GGGG PPP PPPP PPPP Sbjct: 340 GGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP--------T 391 Query: 136 GGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 GPPP PPP G P P PPS G Sbjct: 392 NGPPP-PPPPTNGPPPPPPPTNG--PPSEG 418 Score = 36.3 bits (80), Expect = 0.043 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP---PXXPPPXXGGP 93 PPPP PPPP G PP P PPP GP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGP---PPXXPPPXXGGPXFXP 81 PPPP PPPP G P PP PPP G P P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP G PPP PP G Sbjct: 385 PPPPPPTNGPPPPPPPT--NGPPPPPPPTNGPPSEG 418 Score = 32.3 bits (70), Expect = 0.71 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP P PPP GP P N P P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGP--PPPPPPTNGPPPPP 398 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 39.9 bits (89), Expect = 0.004 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP PPPP GGG G P P PP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 37.9 bits (84), Expect = 0.014 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP GGG G PP PPP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPG--PPKPPPP 683 Score = 35.9 bits (79), Expect = 0.057 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PP G PPPP GGG PPP PP GP P Sbjct: 644 PPNPFFGGIPPPPP---GGGMFPPPPPPPPGGGVPGPPKPP 681 Score = 33.9 bits (74), Expect = 0.23 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PP G PPPP GGG PPP PPP GG Sbjct: 644 PPNPFFGGIPPPPP----GGGMFPPPP--PPPPGGG 673 Score = 29.1 bits (62), Expect = 6.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPP 153 PP GGG G PP PPPP Sbjct: 667 PPPPGGGVPG--PPKPPPP 683 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 38.3 bits (85), Expect = 0.011 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 8/50 (16%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXP--------PPPXXXXGGGGXPXXXXGGGG 207 G GPP G G GGGPP P PPP GGG P GGG Sbjct: 498 GQGGGPPPPGAG-QGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGG 546 Score = 35.9 bits (79), Expect = 0.057 Identities = 27/83 (32%), Positives = 28/83 (33%), Gaps = 8/83 (9%) Frame = -1 Query: 316 GGGGXPPPP-XXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPP-XXXXGAPPPPXXXXG-- 149 G GG PPPP + PPPP G PPPP G Sbjct: 498 GQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWG 557 Query: 148 ----GGXXGGPPPXPPPXXXGGP 92 G GG PP PP GGP Sbjct: 558 QPPPGAGQGGGPP-PPGAGQGGP 579 Score = 35.9 bits (79), Expect = 0.057 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 8/49 (16%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXP--------PPPXXXXGGGGXPXXXXGGG 204 G GPP G G GGGPP P PPP GGG P GG Sbjct: 531 GQGGGPPPPGAG-QGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGG 578 Score = 35.5 bits (78), Expect = 0.076 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-----XXPPPXXGGPXFXP 81 PPP G PPPP G G GGPPP PPP G P Sbjct: 559 PPPGAGQGGGPPPP-----GAGQGGPPPPGAGQEGPPPPGAGQGGGP 600 Score = 35.5 bits (78), Expect = 0.076 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-----XXPPPXXGG 96 PPPP G PPPP G G G PPP PPP G Sbjct: 569 PPPPGAGQGGPPPP----GAGQEGPPPPGAGQGGGPPPPGAG 606 Score = 35.1 bits (77), Expect = 0.10 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPX-----PPPPXXXXGGGGXPXXXXGGGG 207 G GPP G G G PP PPPP GGG P G G Sbjct: 564 GQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWG 610 Score = 33.5 bits (73), Expect = 0.31 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 7/49 (14%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPX-------PPPPXXXXGGGGXPXXXXGGGG 207 G GPP G G G PP PPPP GGG P G G Sbjct: 509 GQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWG 557 Score = 33.5 bits (73), Expect = 0.31 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 7/60 (11%) Frame = -3 Query: 206 PPPPXX-XXGXPPPPXXXXG------GGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPPP G PPPP G G G GG PP P GGP P + P G Sbjct: 536 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPP-PPGAGQGGPP-PPGAGQEGPPPPG 593 Score = 33.5 bits (73), Expect = 0.31 Identities = 22/62 (35%), Positives = 24/62 (38%), Gaps = 6/62 (9%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGP----PPXPPPXXXGGPXFXPXXR--XVIPPSRGL 44 PPP G PPPP GG G PP P GGP + + PP GL Sbjct: 559 PPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPPGSGL 618 Query: 43 KL 38 L Sbjct: 619 HL 620 Score = 33.1 bits (72), Expect = 0.40 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 13/55 (23%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGG--------GXGGPPP-----XXPPPXXGGPXFXP 81 PPP G PPPP GGG G G PPP PPP G P Sbjct: 493 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGP 547 Score = 33.1 bits (72), Expect = 0.40 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 7/49 (14%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPP-------XXPPPXXXXGGGGAPXXXXGGGG 206 G GPP G GG PP PPP GGG P GGG Sbjct: 498 GQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGG 546 Score = 31.9 bits (69), Expect = 0.93 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPP G PPPP G GGPPP G P Sbjct: 493 PPPGAGQGGGPPPPGA----GQGGGPPPPGAGQGWGQP 526 Score = 30.7 bits (66), Expect = 2.2 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 7/48 (14%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPP-------XXPPPXXXXGGGGAPXXXXGGG 203 G GPP G GG PP PPP GGG P GG Sbjct: 531 GQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGG 578 Score = 30.3 bits (65), Expect = 2.8 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXP------PPPXXXXGGGGXPXXXXGGGG 207 G G P G G GGGPP P PPP G P GGG Sbjct: 553 GQGWGQPPPGAGQ-GGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGG 599 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP 123 PPPP G PPP G G G PPP Sbjct: 589 PPPPGAGQGGGPPP--PGAGQGWGLPPP 614 Score = 29.5 bits (63), Expect = 5.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXP----PPXXXXGGGGAPXXXXGGGG 206 G GPP G G GG PP PP G GG P G G Sbjct: 564 GQGGGPPPP-GAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQG 608 Score = 29.1 bits (62), Expect = 6.6 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG G G P PP GGG P GGG Sbjct: 485 GGGQGWGQP---PPGAGQGGGPPPPGAGQGGG 513 Score = 28.7 bits (61), Expect = 8.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 G G P G G GG PPP GGG P G G Sbjct: 487 GQGWGQPPPGAGQGGG-----PPPPGAGQGGGPPPPGAGQG 522 Score = 28.7 bits (61), Expect = 8.7 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 8/46 (17%) Frame = -3 Query: 206 PPPPXXXXGX--PPPPXXXXGG------GGXGGPPPXXPPPXXGGP 93 PPPP G PPP GG G GGPPP G P Sbjct: 514 PPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQP 559 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPP PPP PPP P P PP L+L P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAP 440 Score = 35.5 bits (78), Expect = 0.076 Identities = 21/58 (36%), Positives = 23/58 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTA 32 PPPP PPPP PPP PPP P P R P R L+ T+ Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP----PPPPPALRLACAPPR-LRFTS 447 Score = 35.1 bits (77), Expect = 0.10 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP PPP PPP P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 34.7 bits (76), Expect = 0.13 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP PPPP PP PPP P P PP+ Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P P PPP P P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 34.3 bits (75), Expect = 0.17 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP PPP PPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 32.7 bits (71), Expect = 0.53 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P P P P Sbjct: 369 PPPPPPPPSPPPPPPPPP----PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 32.3 bits (70), Expect = 0.71 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP P P PPP P P P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 36.7 bits (81), Expect = 0.033 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PP G PPPP GG G PPP PP Sbjct: 376 PPGAGNGPGGPPPPWSKPGGILPGPPPPGPP 406 Score = 33.9 bits (74), Expect = 0.23 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PP G PPPP GG GPPP PP P P Sbjct: 376 PPGAGNGPGGPPPPWSKP-GGILPGPPPPGPPMLNMAPSIPP 416 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 36.7 bits (81), Expect = 0.033 Identities = 19/41 (46%), Positives = 20/41 (48%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPP G PPP GG GG PP PPP G P + P Sbjct: 209 PPPM---GGPPPM-----GGPPGGYPPPPPPPGAGDPAYPP 241 Score = 35.9 bits (79), Expect = 0.057 Identities = 19/41 (46%), Positives = 20/41 (48%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP G PPP GG GG PP PPP G P + P Sbjct: 209 PPPM---GGPPPM-----GGPPGGYPPPPPPPGAGDPAYPP 241 Score = 31.9 bits (69), Expect = 0.93 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 GPP GG GGPP PP G G P Sbjct: 208 GPPPMGGPPPMGGPPGGYPPPPPPPGAGDP 237 Score = 29.9 bits (64), Expect = 3.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 200 PPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PP PPP GGG G P PPP Sbjct: 102 PPLQQRQQHPPPGHPPMGGGYPGQQPGGPPP 132 Score = 29.5 bits (63), Expect = 5.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPP G PPP G G PPP Sbjct: 215 PPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 29.1 bits (62), Expect = 6.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP 123 PPP G PPP G G PPP Sbjct: 215 PPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 28.7 bits (61), Expect = 8.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 93 GPPXXXGGGXGGGPPXXPPPXXXXGGGGAP 182 GPP G GGPP PP G G P Sbjct: 208 GPPPMGGPPPMGGPPGGYPPPPPPPGAGDP 237 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 36.7 bits (81), Expect = 0.033 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP--PXXXGGPXFXPXXRXVIPPSRGLKLTA 32 PPP APPPP GGPPP PP P G P P P+ + L A Sbjct: 128 PPPTSPATRAPPPPPPI--APATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAA 185 Score = 35.1 bits (77), Expect = 0.10 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPP G PPP P GGP P Sbjct: 127 PPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPP 168 Score = 35.1 bits (77), Expect = 0.10 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXX--GXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP G PPPP GG PPP P P P GP Sbjct: 140 PPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGP 195 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPP G PPP P GGP P Sbjct: 127 PPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPP 168 Score = 33.5 bits (73), Expect = 0.31 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 4/62 (6%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGG----XXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKL 38 PPPP P P GGPPP PPP P P PP G L Sbjct: 166 PPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP--PPILELAAPPPPGSVL 223 Query: 37 TA 32 A Sbjct: 224 GA 225 Score = 33.1 bits (72), Expect = 0.40 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 4/69 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP----PXPPPXXXGGPXFXPXXRXVIPPSRGLKL 38 PPP G PPPP P PP GGP P PP L+L Sbjct: 154 PPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILEL 213 Query: 37 TAXPSXSXV 11 A P V Sbjct: 214 AAPPPPGSV 222 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP PPPP G PPP P G P P Sbjct: 128 PPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGX----GGPPPXXPPPXXGGP 93 PPPP P P GGPPP PPP P Sbjct: 166 PPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 29.9 bits (64), Expect = 3.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 651 GGXXPPXPXPPPPP 692 GG PP P PPPPP Sbjct: 193 GGPPPPPPPPPPPP 206 Score = 29.5 bits (63), Expect = 5.0 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = -1 Query: 205 PPP--PXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPP P AP PP PPP P GGP P Sbjct: 112 PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP 155 Score = 29.1 bits (62), Expect = 6.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 648 GGGXXPPXPXPPPPP 692 GG PP P PPPPP Sbjct: 193 GGPPPPPPPPPPPPP 207 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXG 134 PPPP APPPP G G Sbjct: 206 PPPPILELAAPPPPGSVLGAALTG 229 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 36.3 bits (80), Expect = 0.043 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP---PXXXGGPXFXPXXRXVIPPS 53 PPPP APPPP PP PP P GGP P R PPS Sbjct: 331 PPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR--PPS 382 Score = 34.7 bits (76), Expect = 0.13 Identities = 23/87 (26%), Positives = 23/87 (26%) Frame = -1 Query: 307 GXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGP 128 G PPPP PPPP G PPPP P Sbjct: 172 GKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAP 231 Query: 127 PPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PP P P PP RG Sbjct: 232 PPTGSSRPLPAP--PPGENRPPPPMRG 256 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYSXT 27 P P PPPP GG PP PPP G P P GP + S T Sbjct: 241 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPP-----PPTRGPPSNSFT 294 Score = 31.9 bits (69), Expect = 0.93 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = -1 Query: 205 PPP---PXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP P G PPPP PPP PPP Sbjct: 359 PPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 30.7 bits (66), Expect = 2.2 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 P P PPPP G PP PP G P PPS P Sbjct: 241 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPP 299 Score = 29.1 bits (62), Expect = 6.6 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP---PPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PP P P GGP P S P Sbjct: 331 PPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINP 387 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 36.3 bits (80), Expect = 0.043 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP---PXXXGGPXFXPXXRXVIPPS 53 PPPP APPPP PP PP P GGP P R PPS Sbjct: 243 PPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR--PPS 294 Score = 34.7 bits (76), Expect = 0.13 Identities = 23/87 (26%), Positives = 23/87 (26%) Frame = -1 Query: 307 GXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGP 128 G PPPP PPPP G PPPP P Sbjct: 84 GKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAP 143 Query: 127 PPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PP P P PP RG Sbjct: 144 PPTGSSRPLPAP--PPGENRPPPPMRG 168 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYSXT 27 P P PPPP GG PP PPP G P P GP + S T Sbjct: 153 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPP-----PPTRGPPSNSFT 206 Score = 31.9 bits (69), Expect = 0.93 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = -1 Query: 205 PPP---PXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP P G PPPP PPP PPP Sbjct: 271 PPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 30.7 bits (66), Expect = 2.2 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 P P PPPP G PP PP G P PPS P Sbjct: 153 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPP 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP---PPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PP P P GGP P S P Sbjct: 243 PPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINP 299 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 36.3 bits (80), Expect = 0.043 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPP A PPP G PPP PPP GGP Sbjct: 292 PPPFGGHPAAAPPPPPLPAG--VPAPPPPPPPPMLGGP 327 Score = 33.9 bits (74), Expect = 0.23 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 9/47 (19%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG---------GGXGGPPPXXPPPXXGGP 93 PPPP G PPP G PPP PPP GGP Sbjct: 281 PPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 33.5 bits (73), Expect = 0.31 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G PPP GG PPP P P P P Sbjct: 281 PPPPPLTGGMLPPPF---GGHPAAAPPPPPLPAGVPAPPPPP 319 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 36.3 bits (80), Expect = 0.043 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXP---PPXXXGGPXFXPXXRXVIPPSRG 47 PPP G PP P G GGPP P PP G P + PP RG Sbjct: 428 PPPPQHTG-PPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRG 481 Score = 35.1 bits (77), Expect = 0.10 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXX-PPPXXGGP 93 PPPP G PPPP PPP PPP GP Sbjct: 459 PPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGP 497 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXG 48 PPP P PP GGG PP PPP G P P G Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRG 481 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXP--PPXXGG 96 PPP G PP P G GGPP P PP GG Sbjct: 428 PPPPQHTG-PPQPRPPHGMPQGGGPPQLPPNLPPPPGG 464 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 35.9 bits (79), Expect = 0.057 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 196 PXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 P G PPPP G GG PP PPP P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 35.1 bits (77), Expect = 0.10 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 197 PXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 P G PPPP G GG PP PPP P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP GAPPPP G PPP GGP Sbjct: 201 PPPPGFPGGAPPPPPPPFGA--------PPPPALNGGP 230 Score = 33.1 bits (72), Expect = 0.40 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 P P PPPP G G G PPP PPP G P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPG-GAPPP--PPPPFGAP 221 Score = 31.9 bits (69), Expect = 0.93 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP G PPPP G PP PP GGP Sbjct: 201 PPPPGFPGGAPPPPPPP-----FGAPP---PPALNGGP 230 Score = 30.3 bits (65), Expect = 2.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPP 153 PP G GG PP PPPP Sbjct: 199 PPPPPPGFPGGAPPPPPPP 217 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 35.5 bits (78), Expect = 0.076 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP GAP P GG PPP P P GG Sbjct: 181 PPPP----GAPAAPPAPPFGGPPSAPPPPPAPPVGGG 213 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP P PP GG PPP PP GG Sbjct: 181 PPPPGAPAAPPAPPF----GGPPSAPPPPPAPPVGGG 213 Score = 29.5 bits (63), Expect = 5.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGA 179 G PP GG PP PPP GGGG+ Sbjct: 185 GAPAAPPAPPFGGPPSAPP--PPPAPPVGGGGS 215 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPPP GG PP PPP GG Sbjct: 196 PPPPPGPGGIPPPPPPI-----RGGVPP--PPPMGGG 225 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP 116 PPPP G PPP GG PPP P Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGV---PPPPP 221 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.3 bits (75), Expect = 0.17 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP APPPP P P PPP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP 96 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP P P PPP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP P PPP P F P Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP--APPHFLP 114 Score = 29.9 bits (64), Expect = 3.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 P PP PPPP PP PPP Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPP 87 Score = 28.7 bits (61), Expect = 8.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 P PP APPPP PPP PP P P Sbjct: 55 PSPPAAAPAAPPPP----AAAPAAPPPPAAPPAAPPPPPPLP 92 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 34.3 bits (75), Expect = 0.17 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGG--GXXGGPPP-XPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPP G PPP G G G PPP PPP GG PPS G+ Sbjct: 248 PPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPPSSGV 304 Score = 33.5 bits (73), Expect = 0.31 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG-GGXGG-PPPXXPPPXXGG 96 PPP G PPP G G GG PPP PPP G Sbjct: 248 PPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPG 286 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP---PPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PP P PPP P PP P + P N P P Sbjct: 180 PPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 P PP PPPP PPP P P + P PPS Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Score = 30.7 bits (66), Expect = 2.2 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 7/61 (11%) Frame = -3 Query: 206 PPPPXXXXGXP--PPPXXXXGGGGXGGPPPXXPP-----PXXGGPXFXPXXXEXNSPXXG 48 PPPP P PPP PPP PP P P + P N P Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPN 208 Query: 47 P 45 P Sbjct: 209 P 209 Score = 28.7 bits (61), Expect = 8.7 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -1 Query: 205 PPPPXXXXGAP-PPPXXXXGGGXXGGPPPXPP-PXXXGGPXFXPXXRXVIPP 56 PPP AP PPP PPP PP P P P PP Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 33.9 bits (74), Expect = 0.23 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP G GPP P P GP P Sbjct: 29 PPPPPPYEAPPPPP----GPPGPDGPPGFPGPQGPNGPKGPP 66 Score = 33.5 bits (73), Expect = 0.31 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP G G GPP P GP P Sbjct: 29 PPPPPPYEAPPPPP----GPPGPDGPPGFPGPQGPNGPKGPP 66 Score = 32.7 bits (71), Expect = 0.53 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXF 86 PP P GAP P G G P PP GGP + Sbjct: 208 PPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGY 247 Score = 32.7 bits (71), Expect = 0.53 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXF 86 PP P GAP P G G P PP GGP + Sbjct: 293 PPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGY 332 Score = 32.7 bits (71), Expect = 0.53 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXF 86 PP P GAP P G G P PP GGP + Sbjct: 378 PPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGY 417 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXF 86 PP P GAP P G G P PP GGP + Sbjct: 463 PPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGY 502 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXF 86 PP P GAP P G G P PP GGP + Sbjct: 548 PPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGY 587 Score = 30.7 bits (66), Expect = 2.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP-PXXP--PPXXGGPXFXP 81 PPPP PP P G G GP P P PP GP P Sbjct: 31 PPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP-PXXPPPXXGGP 93 PP P G PP P G G GPP PP GGP Sbjct: 123 PPGPPGLPG-PPGPAGPPGTNGELGPPGDVGPPGNPGGP 160 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 PP P G P P G G P PP GGP + Sbjct: 208 PPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGY 247 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 PP P G P P G G P PP GGP + Sbjct: 293 PPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGY 332 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 PP P G P P G G P PP GGP + Sbjct: 378 PPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGY 417 Score = 29.9 bits (64), Expect = 3.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PP P G P P G G P PP GGP Sbjct: 123 PPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNPGGP 160 Score = 29.5 bits (63), Expect = 5.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -3 Query: 206 PPPPXXXXGXPPPP--XXXXGGGGXGGPP--PXXP-PPXXGGPXFXP 81 PPPP G PP G G GPP P P PP GP P Sbjct: 38 PPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNP 84 Score = 29.1 bits (62), Expect = 6.6 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXG--GPP--PXPP-PXXXGGPXFXP 80 PPPP G PP G G GPP P PP P GP P Sbjct: 38 PPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNP 84 Score = 29.1 bits (62), Expect = 6.6 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 PP P G P P G G P PP GGP + Sbjct: 463 PPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGY 502 Score = 29.1 bits (62), Expect = 6.6 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 PP P G P P G G P PP GGP + Sbjct: 548 PPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGY 587 Score = 28.7 bits (61), Expect = 8.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 GPP G GPP PP P G G P Sbjct: 101 GPPGELGDMGPPGPPGPPGPQMPPGPPGLP 130 Score = 28.7 bits (61), Expect = 8.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 P P G P PP G G P P PP G P Sbjct: 264 PGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLP 300 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 33.5 bits (73), Expect = 0.31 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP +PPPP PPP PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 32.7 bits (71), Expect = 0.53 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP-PPXXXGGPXFXPXXRXVIPPS 53 PPPP PPPP PPP P PP P +PP+ Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPT 257 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP PPP P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP PPP PP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 33.1 bits (72), Expect = 0.40 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP PPP PP G P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 32.3 bits (70), Expect = 0.71 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PP G P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 5/59 (8%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP-----XXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PP G P P +P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQP 741 Score = 28.7 bits (61), Expect = 8.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = -1 Query: 205 PP--PPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PP PP GAP P G G P PPP Sbjct: 710 PPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPP 743 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 33.1 bits (72), Expect = 0.40 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPP G PPP PPP Sbjct: 53 PPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 29.5 bits (63), Expect = 5.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPPP PPP G PPP PP Sbjct: 53 PPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 23.8 bits (49), Expect(2) = 5.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 233 PPPPPPP 253 PPPPPPP Sbjct: 50 PPPPPPP 56 Score = 23.8 bits (49), Expect(2) = 5.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 236 PPPPPPP 256 PPPPPPP Sbjct: 78 PPPPPPP 84 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 33.1 bits (72), Expect = 0.40 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G GGG GGG P P GGG P GGG Sbjct: 331 GDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGG 368 Score = 32.7 bits (71), Expect = 0.53 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 64 LXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 L S L G G G GGG P P GGG P GGG Sbjct: 316 LVSALCSVDGGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGG 363 Score = 29.1 bits (62), Expect = 6.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 109 GGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 GGG GGG P P GGG GGG Sbjct: 341 GGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGG 373 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 32.3 bits (70), Expect = 0.71 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 9/49 (18%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGG------XGGPP---PXXPPPXXGGPXF 87 PPP G PPPP G GG G PP P PP G P + Sbjct: 59 PPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGAPPTSGYPGY 107 Score = 29.1 bits (62), Expect = 6.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP-XXPPPXXG 99 PP P G PP P GG G PP PPP G Sbjct: 31 PPAPG---GYPPAPGGYPPSGGYGYPPAGGYPPPQPG 64 Score = 28.7 bits (61), Expect = 8.7 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP----PXPPPXXXGGP 92 PP P G PP P G G PP P P P GGP Sbjct: 31 PPAPG---GYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGP 69 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 32.3 bits (70), Expect = 0.71 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 114 GGXGGGPPXXPPPXXXXGGGGAPXXXXG 197 GG GGGPP PP G GAP G Sbjct: 68 GGYGGGPPRGPPRGHPMRGRGAPYGRGG 95 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 32.3 bits (70), Expect = 0.71 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = -1 Query: 202 PPPXXXXGAPPP---PXXXXGGGXXGGPPPXPPP 110 PPP GAPP P GG GGPPP P Sbjct: 237 PPPGGYPGAPPAGGYPGAPPPGGYPGGPPPANYP 270 Score = 30.7 bits (66), Expect = 2.2 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP-XXXGGP 92 PPP G PPP G GG P PPP GGP Sbjct: 230 PPPQ---GYAPPPGGYPGAPPAGGYPGAPPPGGYPGGP 264 Score = 30.3 bits (65), Expect = 2.8 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 13/63 (20%) Frame = -1 Query: 205 PPP---PXXXXGAP----PPPXXXXGGGXXGG--PPPX----PPPXXXGGPXFXPXXRXV 65 PPP P G P PPP G GG PPP PPP P + P Sbjct: 157 PPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYVPQEGGG 216 Query: 64 IPP 56 IPP Sbjct: 217 IPP 219 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 32.3 bits (70), Expect = 0.71 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP APPPP PPP PPP Sbjct: 301 PPPPPPTDFAPPPPPPEPTSEL---PPPPPPP 329 Score = 29.9 bits (64), Expect = 3.8 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAY 36 PPPP PPPP G G P PPP P P P P + Sbjct: 280 PPPP------PPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPPF 330 Score = 28.7 bits (61), Expect = 8.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP F G PPP Sbjct: 280 PPPPPPPP--SNTPGMFASSGFQPPPPP 305 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPP PPP G G PP PP G P P +SP Sbjct: 2174 PPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPP-MGAPPMGPPPSGSHSP 2222 Score = 29.1 bits (62), Expect = 6.6 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 4/58 (6%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXX----XXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP PPPP G G PP PPP G P P +P GP Sbjct: 2140 PPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPP-MGAPPSGP--PPMGAPPSGP 2194 Score = 28.7 bits (61), Expect = 8.7 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 P P PPP G G PP PPP P P +P GP Sbjct: 2164 PSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHP---PMGAPPMGP 2214 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 645 GGGGXXPPXPXPPPPP 692 G GG PP P PPPPP Sbjct: 788 GVGGITPPPPPPPPPP 803 Score = 29.9 bits (64), Expect = 3.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 679 GXGXGGXXPPPPXXPPXXXP 620 G G GG PPPP PP P Sbjct: 786 GEGVGGITPPPPPPPPPPPP 805 Score = 28.7 bits (61), Expect = 8.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 636 GXXGGGGXXPPXPXPPPPP 692 G GG PP P PPPPP Sbjct: 786 GEGVGGITPPPPPPPPPPP 804 >SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) Length = 351 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 117 GXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G GGG P P GGGG+P GGGG Sbjct: 18 GGGGGSPTEAP----GGGGGSPTEAPGGGG 43 Score = 29.1 bits (62), Expect = 6.6 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 100 PXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 P GG GGG P P GGGG P GGGG Sbjct: 14 PQAPGG--GGGSPTEAP----GGGGGSPTEAPGGGG 43 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 30.7 bits (66), Expect = 2.2 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNS 60 PP P G PP G GGPP P G P P + +S Sbjct: 405 PPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPPMRPGRFDHDS 453 Score = 29.5 bits (63), Expect = 5.0 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = -3 Query: 200 PPXXXXGXPPPPXXXXGGGGXG---GPPPXXPPPXXGGPXFXPXXXEXN-SPXXGP 45 P G PP G G G GPP PP GP F P + P GP Sbjct: 379 PGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGP 434 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP P P G G GP PP GP P Sbjct: 1665 PPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIP 1706 Score = 29.9 bits (64), Expect = 3.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP-PXXPPPXXGGP 93 PPPP PP P G G GP P PP G P Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLP 1700 Score = 28.7 bits (61), Expect = 8.7 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = -1 Query: 205 PPPPXXXXGAPPP--PXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP G P P P G GP P P GP P Sbjct: 1663 PPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIP 1706 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP G PPP G P P PPP P P Sbjct: 73 PPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPP 114 Score = 29.9 bits (64), Expect = 3.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP G PPP G P P PPP P P Sbjct: 53 PPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPP 94 Score = 29.9 bits (64), Expect = 3.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPP G PPP G P P PPP P P Sbjct: 63 PPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPP 104 Score = 29.5 bits (63), Expect = 5.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPP G PPP G P P PPP Sbjct: 83 PPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 29.9 bits (64), Expect = 3.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 29.9 bits (64), Expect = 3.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 29.9 bits (64), Expect = 3.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 29.5 bits (63), Expect = 5.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 29.5 bits (63), Expect = 5.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 29.5 bits (63), Expect = 5.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 29.5 bits (63), Expect = 5.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 636 GXXGGGGXXPPXPXPPPPP 692 G G G PP P PPPPP Sbjct: 455 GDTEGVGQAPPPPPPPPPP 473 Score = 29.5 bits (63), Expect = 5.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP PPP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPP----PPPPPPFPPPP 492 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 633 GGXXGGGGXXPPXPXPPPPP 692 G G G PP P PPPPP Sbjct: 455 GDTEGVGQAPPPPPPPPPPP 474 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.5 bits (63), Expect = 5.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PP P PPPP PP PPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPP 246 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 29.5 bits (63), Expect = 5.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 29.1 bits (62), Expect = 6.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGG GGGG GGGG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 28.7 bits (61), Expect = 8.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 28.7 bits (61), Expect = 8.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GGG GGG GGGG GGGG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPP 110 PPPP G PPP PPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPP 776 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPP 113 PPPP G G PPP PP Sbjct: 757 PPPPPAVPGEGARPPPPPPPP 777 Score = 28.7 bits (61), Expect = 8.7 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 7/43 (16%) Frame = -1 Query: 205 PPPPXXXXGAP-------PPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP G P PP G PPP PPP G Sbjct: 689 PPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLG 731 Score = 28.7 bits (61), Expect = 8.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPP 110 PPPP G PPP PPP Sbjct: 756 PPPPPPAVPGEGARPPPPPPPP 777 Score = 24.2 bits (50), Expect(2) = 5.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 236 PPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPP G G PPP Sbjct: 755 PPPPPPPA--------VPGEGARPPPP 773 Score = 23.4 bits (48), Expect(2) = 5.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 233 PPPPPPPP 256 PP PPPPP Sbjct: 722 PPAPPPPP 729 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 29.1 bits (62), Expect = 6.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP +PPPP PPP PPP Sbjct: 1163 PPPPPPSSPSPPPPP----------PPPPPPP 1184 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 29.1 bits (62), Expect = 6.6 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = -1 Query: 205 PPPPXXXXGAPPP-PXXXXGGGXXGGPPPXPPPXXXG 98 P P APPP P G GPPP PP G Sbjct: 809 PKLPTANPDAPPPLPLTYGVGSMSKGPPPRPPGDHIG 845 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 24.2 bits (50), Expect(2) = 7.2 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -1 Query: 130 PPPXPPPXXXGGPXFXPXXRXVIP 59 PPP PPP P P ++P Sbjct: 459 PPPPPPPQMYQQPLMMPQAPMMMP 482 Score = 23.0 bits (47), Expect(2) = 7.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 133 GPPPXPPP 110 GPPP PPP Sbjct: 456 GPPPPPPP 463 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 28.7 bits (61), Expect = 8.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 28.7 bits (61), Expect = 8.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 28.7 bits (61), Expect = 8.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 28.7 bits (61), Expect = 8.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 28.7 bits (61), Expect = 8.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 114 GGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GG GG P GGGGA GGGG Sbjct: 474 GGVGGRSIWNVVPGGFGGGGGASGGGGGGGG 504 >SB_45874| Best HMM Match : TIR (HMM E-Value=0.43) Length = 876 Score = 28.7 bits (61), Expect = 8.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 151 GGGXXGGPPPXPPPXXXGGP 92 GG GPPP PPP GP Sbjct: 298 GGTCSSGPPPPPPPPTSIGP 317 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 28.7 bits (61), Expect = 8.7 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXG-GGXXGGPPPXPP 113 PPPP PPPP PPP PP Sbjct: 137 PPPPAKEAPLPPPPAQQEAVPDIPTSPPPVPP 168 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 28.7 bits (61), Expect = 8.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGG 115 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 24.6 bits (51), Expect(2) = 9.0 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 654 GXXPPXPXPPPP 689 G PP P PPPP Sbjct: 71 GSTPPQPTPPPP 82 Score = 22.6 bits (46), Expect(2) = 9.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 663 PPXPXPPPPP 692 PP P PPPP Sbjct: 81 PPRPPTPPPP 90 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,626,039 Number of Sequences: 59808 Number of extensions: 368082 Number of successful extensions: 7937 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5076 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3320070040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -