BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L01 (1093 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61080.1 68414.m06877 proline-rich family protein 44 2e-04 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 42 0.001 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 40 0.004 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 39 0.007 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 38 0.015 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 36 0.036 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 36 0.036 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 36 0.047 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 35 0.082 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 35 0.082 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 35 0.11 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 35 0.11 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 34 0.14 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 34 0.19 At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family pr... 33 0.25 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 33 0.25 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 33 0.25 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 33 0.25 At1g15830.1 68414.m01900 expressed protein 33 0.25 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 33 0.33 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 33 0.33 At3g04610.1 68416.m00493 KH domain-containing protein similar pu... 33 0.33 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 33 0.44 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 32 0.58 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 32 0.58 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 32 0.58 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 32 0.58 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 32 0.58 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 31 1.0 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 31 1.0 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 31 1.0 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 31 1.0 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 31 1.0 At4g23882.1 68417.m03434 heavy-metal-associated domain-containin... 31 1.0 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 31 1.3 At4g18570.1 68417.m02749 proline-rich family protein common fami... 31 1.3 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 31 1.3 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 31 1.3 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 31 1.3 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 31 1.3 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 31 1.8 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 31 1.8 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 31 1.8 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 31 1.8 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 31 1.8 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 30 2.3 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 30 2.3 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 30 2.3 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 30 2.3 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 30 2.3 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 30 2.3 At2g47700.1 68415.m05957 zinc finger (C3HC4-type RING finger) fa... 30 2.3 At1g70470.1 68414.m08108 expressed protein 30 2.3 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 30 2.3 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 30 2.3 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 30 3.1 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 30 3.1 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 30 3.1 At3g10300.3 68416.m01236 calcium-binding EF hand family protein ... 30 3.1 At3g10300.2 68416.m01235 calcium-binding EF hand family protein ... 30 3.1 At3g10300.1 68416.m01234 calcium-binding EF hand family protein ... 30 3.1 At1g29380.1 68414.m03592 hypothetical protein 30 3.1 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 30 3.1 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 30 3.1 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 29 4.1 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 29 4.1 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 29 4.1 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 4.1 At3g08530.1 68416.m00990 clathrin heavy chain, putative similar ... 29 4.1 At2g18470.1 68415.m02151 protein kinase family protein contains ... 29 4.1 At1g26150.1 68414.m03192 protein kinase family protein similar t... 29 4.1 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 29 4.1 At1g02710.1 68414.m00222 glycine-rich protein 29 4.1 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 24 4.7 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 29 5.4 At3g24550.1 68416.m03083 protein kinase family protein contains ... 29 5.4 At3g11130.1 68416.m01349 clathrin heavy chain, putative similar ... 29 5.4 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 29 5.4 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 29 5.4 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 29 7.1 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 29 7.1 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 29 7.1 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 29 7.1 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 29 7.1 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 29 7.1 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 29 7.1 At2g30560.1 68415.m03722 glycine-rich protein 29 7.1 At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid t... 29 7.1 At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid t... 29 7.1 At1g27710.1 68414.m03387 glycine-rich protein 29 7.1 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 29 7.1 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 29 7.1 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 29 7.1 At3g50180.1 68416.m05486 hypothetical protein 24 7.8 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 28 9.4 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 28 9.4 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 28 9.4 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 28 9.4 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 9.4 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 9.4 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 28 9.4 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP AP PP G GGPPP PPP Sbjct: 565 PPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPP 596 Score = 41.5 bits (93), Expect = 0.001 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPPP P PP G G GGPPP PP Sbjct: 565 PPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPP 596 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP PPP P NS GP Sbjct: 539 PPPPPGTAAAPPPPPPPPGT--QAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGP 590 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP A PPP G PPP PPP P P Sbjct: 538 PPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP APPPP G PPP PPP P P Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAA-APPPPPPPPGTQAAPPPPP 566 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP PPP G G PPP PP G Sbjct: 566 PPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANG 602 Score = 35.9 bits (79), Expect = 0.047 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP G PPP P P P + +P P Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Score = 35.5 bits (78), Expect = 0.062 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP A PPP PPP PPP P P Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPP 553 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPP G PPP PP P P N P Sbjct: 525 PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPP 578 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP G GGPP PPPP G P Sbjct: 578 PPMPMGNSGSGGPPPPPPPMPLANGATPP 606 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPP APPPP PPP PP P P Sbjct: 513 PPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPP 554 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXX--GGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPP G GG PPP P P P + GP Sbjct: 566 PPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGP 621 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/73 (26%), Positives = 19/73 (26%) Frame = -1 Query: 316 GGGGXPPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXX 137 G PPPP PPP GA PPP Sbjct: 557 GTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMAN 616 Query: 136 GGPPPXPPPXXXG 98 G P PPP G Sbjct: 617 GAAGPPPPPPRMG 629 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAP 182 PP G GGPP PPP G P Sbjct: 578 PPMPMGNSGSGGPPPPPPPMPLANGATPP 606 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP APPPP P P P P G P +P + G Sbjct: 552 PPPPPGTQAAPPPPPPPPMQNR--APSPPPMPMGNSGSGGPPPPPPPMPLANG 602 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = -3 Query: 206 PPPPXXXX----GXPPPPXXXXGGGGXGGPPPXXPP 111 PPPP G PPPP G GPPP PP Sbjct: 608 PPPPMAMANGAAGPPPPPPRMGMANGAAGPPP--PP 641 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPP PPP PP P P Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPP 553 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP G G G P PPPP G P Sbjct: 577 PPPMPMGNSGSGGPPPPPPPMPLANGATP 605 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 5/33 (15%) Frame = +2 Query: 233 PPPPPPPP-----XXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP G GG PPP Sbjct: 562 PPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPP 594 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG-GPXFXPXXRXVIPP 56 PPPP APPPP G PPP PPP G GP P PP Sbjct: 385 PPPPPPSAAAPPPPPPPKKG--PAAPPPPPPPGKKGAGPPPPPPMSKKGPP 433 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP APPPP G G PP PPP GP P Sbjct: 398 PPPPKKGPAAPPPPPPP---GKKGAGPPPPPPMSKKGPPKPP 436 Score = 35.5 bits (78), Expect = 0.062 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG-GPXFXPXXXEXNSP 57 PPPP PPPP G PPP PP G GP P + P Sbjct: 385 PPPPPPSAAAPPPPPPPK--KGPAAPPPPPPPGKKGAGPPPPPPMSKKGPP 433 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXP--PPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP P PPP G G G PPP PP GP P Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPP--PPMSKKGPPKPP 436 Score = 28.3 bits (60), Expect = 9.4 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 P PP PPP PPP PPP GP P GP Sbjct: 373 PAPPGPANQTSPPPPPPPSA---AAPPP--PPPPKKGPAAPPPPPPPGKKGAGP 421 Score = 28.3 bits (60), Expect = 9.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXG 198 G PP G G GPP PPPP G P G Sbjct: 404 GPAAPPPPPPPGKKGAGPP-PPPPMSKKGPPKPPGNPKG 441 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PPP PPP P + P PP Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP PPP PPP P P Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPP 472 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P +SP P Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP +PPPP PPP PPP Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 P PP PPPP PPP PPP P P P P Sbjct: 429 PSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSP 482 Score = 32.3 bits (70), Expect = 0.58 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPP PPP PPP Sbjct: 473 PPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP-----PXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PP P PPP P P PP Sbjct: 619 PPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPP 673 Score = 31.9 bits (69), Expect = 0.77 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PP PP P P +SP P YS Sbjct: 641 PPPPPVYYSSPPPPPVYYSS------PPPPPPVHYSSP--PPPEVHYHSPPPSPVHYS 690 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPP PP P PPP PPP P P SP P Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPP 455 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPP PP P PPP PPP P P V P Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSP 451 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PPPP PPP PPP P P Sbjct: 466 PPPPPP----PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/64 (28%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXG----GPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKL 38 PPPP +PPPP PP PPP P P PP + Sbjct: 631 PPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPP-PPEVHYHSPPPSPVHY 689 Query: 37 TAXP 26 ++ P Sbjct: 690 SSPP 693 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP +PPPP PPP PPP Sbjct: 482 PPPP-----SPPPPPPPVYSPPPPPPPPPPPP 508 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = -3 Query: 206 PPPPXXXXGXPPP-PXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPP P PP PP P P +SP P YS Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYS 649 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP +PPPP PPP PPP P PPS Sbjct: 487 PPPPPPPVYSPPPP-----------PPPPPPPPVYSPPPPPVYSSPPPPPS 526 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 9/51 (17%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGP---------PPXPPPXXXGGPXFXP 80 PPPP +PPPP P PP PPP P F P Sbjct: 502 PPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSP 552 Score = 29.1 bits (62), Expect = 5.4 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PPP P +SP P YS Sbjct: 609 PPPPPPCIEPPPPPPCI-----EYSPPP--PPPVVHYSSPPPPPVYYSSPPPPPVYYS 659 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP----XXPPPXXGGP 93 PPPP PPPP PPP PPP P Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAP 529 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/84 (23%), Positives = 21/84 (25%), Gaps = 1/84 (1%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP PPPP P P PPP Sbjct: 513 PPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPP 572 Query: 121 -XPPPXXXGGPXFXPXXRXVIPPS 53 PPP P P PP+ Sbjct: 573 HSPPPPHSPPPPIYPYLSPPPPPT 596 Score = 28.3 bits (60), Expect = 9.4 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPPXXP 558 PP P PPP + PPPP P Sbjct: 474 PPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Score = 28.3 bits (60), Expect = 9.4 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPPXXP 558 PP P PPP PPPP P Sbjct: 497 PPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 28.3 bits (60), Expect = 9.4 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PP P P + P P YS Sbjct: 620 PPPPCIEYSPPPPPPVVH----YSSPPP--PPVYYSSPP-PPPVYYSSPPPPPPVHYS 670 Score = 26.6 bits (56), Expect(2) = 0.96 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 233 PPPPPPPP 256 PPPPPPPP Sbjct: 439 PPPPPPPP 446 Score = 23.4 bits (48), Expect(2) = 0.96 Identities = 9/26 (34%), Positives = 10/26 (38%) Frame = +2 Query: 239 PPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPP + PPP Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPP 491 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP G PPPP GGPPP PPP Sbjct: 680 PPPPPPPGGGPPPPPG-------GGPPPPPPP 704 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP G PPPP GGPPP PPP Sbjct: 680 PPPPPPPGGGPPPPPG-------GGPPPPPPPP 705 Score = 36.3 bits (80), Expect = 0.036 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP G PPP GGG PPP PPP G Sbjct: 679 PPPPPPPPGGGPPP--PPGGGP---PPPPPPPGALG 709 Score = 35.9 bits (79), Expect = 0.047 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +1 Query: 82 GXXXGPPXXGGGXX---GGGPPXPPPPXXXXGGG 174 G PP GGG GGGPP PPPP G G Sbjct: 678 GPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRG 711 Score = 35.5 bits (78), Expect = 0.062 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = -1 Query: 196 PXXXXGAPPPPXXXXGGGXX---GGPPPXPPP 110 P G PPPP GGG GG PP PPP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 124 GGGPPXPPPPXXXXGGGGXPXXXXGG 201 GGGPP PPPP GGG P GG Sbjct: 676 GGGPPPPPPPP----GGGPPPPPGGG 697 Score = 32.7 bits (71), Expect = 0.44 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPP G GG PP PPP GGP P PP Sbjct: 654 PPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPP 702 Score = 32.7 bits (71), Expect = 0.44 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +3 Query: 72 LXXGXKXGPPXXXGGG----XGGGPPXXPPPXXXXGGG 173 L G PP GGG GGGPP PPP G G Sbjct: 674 LPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRG 711 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP GGG PPP Sbjct: 679 PPPPPPPPGGGPPPPP---GGGPPPPPP 703 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGG 132 PPPP PPPP G G GG Sbjct: 691 PPPPGGGPPPPPPPPGALGRGAGGG 715 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 123 GGGPPXXPPPXXXXGGGGAPXXXXGG 200 GGGPP PPP GGG P GG Sbjct: 676 GGGPPPPPPPP----GGGPPPPPGGG 697 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGG 131 PPPP PPPP G G GG Sbjct: 691 PPPPGGGPPPPPPPPGALGRGAGGG 715 Score = 29.1 bits (62), Expect = 5.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 167 GGGGXPXXXXXXXXXXXXXXXXPPPPPPPP 256 GGG P PPPPPPPP Sbjct: 676 GGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 29.1 bits (62), Expect = 5.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGG 132 PPPP PPPP G G GG Sbjct: 690 PPPPPGGGPPPPPPPPGALGRGAGG 714 Score = 28.3 bits (60), Expect = 9.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 11/43 (25%) Frame = -3 Query: 176 PPPPXXXXGGGG-----------XGGPPPXXPPPXXGGPXFXP 81 P PP GGG GG PP PPP GGP P Sbjct: 652 PRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPP 694 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP-XXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PPP PPP P F P PP Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPP 583 Score = 31.9 bits (69), Expect = 0.77 Identities = 20/76 (26%), Positives = 22/76 (28%), Gaps = 2/76 (2%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP + PPPP +PPPP PPP Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Query: 121 --XPPPXXXGGPXFXP 80 PPP P P Sbjct: 586 VHSPPPPVHSPPPPAP 601 Score = 29.9 bits (64), Expect = 3.1 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 5/68 (7%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXR---XVI--PPSRGLK 41 PPPP PPP PPP PP P F P V+ PP R K Sbjct: 589 PPPPVH--SPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPK 646 Query: 40 LTAXPSXS 17 + + P S Sbjct: 647 INSPPVQS 654 Score = 26.2 bits (55), Expect(2) = 0.97 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 236 PPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPP F PPP Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPP 584 Score = 23.8 bits (49), Expect(2) = 0.97 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 233 PPPPPPP 253 PPPPPPP Sbjct: 533 PPPPPPP 539 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 36.3 bits (80), Expect = 0.036 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP GGG GGG PPP GGG P GGG Sbjct: 40 PPQHGGG--GGGGSKPPPHHGGKGGGKPPPHGGKGGG 74 Score = 36.3 bits (80), Expect = 0.036 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPP G PP GGGG PP PPP Sbjct: 65 PPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPP 96 Score = 32.3 bits (70), Expect = 0.58 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 8/45 (17%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXX--------PPPXXXXGGGGAPXXXXGGGG 206 PP GGG GG P PP GGG P GGGG Sbjct: 40 PPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGG 84 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G PP GG GG PP GGG P GGGG Sbjct: 48 GGGSKPPPHHGGKGGG-----KPPPHGGKGGGPPHHGGGGGG 84 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGG--PPXPPPP 153 G GPP GGG GGG PP PP Sbjct: 70 GKGGGPPHHGGGGGGGGKSPPVVRPP 95 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = -3 Query: 206 PPP---PXXXXGXPPPPXXXXGGGGXGGPPPXXP 114 PPP P G PP GGGG GG P P Sbjct: 180 PPPVTVPPPSSGYPPYGPPSGGGGGGGGKQPTCP 213 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 633 GGXXGGGGXXPPXPXPPP 686 GG GGGG PP PPP Sbjct: 79 GGGGGGGGKSPPVVRPPP 96 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGG---PPXXPPP 152 G K G P GGG GGG PP PP Sbjct: 69 GGKGGGPPHHGGGGGGGGKSPPVVRPP 95 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 P PP GGGG PPP G P Sbjct: 38 PKPPQHGGGGGGGSKPPPHHGGKGGGKP 65 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 36.3 bits (80), Expect = 0.036 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 P PP PPPP G PP PPP GG Sbjct: 250 PLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGARGG 286 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPP PPPP G G PPP PP GG Sbjct: 252 PPPGTAALPPPPPLPMAAGKGVAAPPPP-PPGARGG 286 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/59 (30%), Positives = 21/59 (35%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPP PPPP PP PPP P P +P + G + A P Sbjct: 224 PPPPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPPP-----LPMAAGKGVAAPP 277 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP G PP PPP Sbjct: 224 PPPPGRAALPPPPPLPMAVRKGVAAPP--LPPP 254 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 35.9 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP PPPP PPP PPP G Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFG 629 Score = 35.5 bits (78), Expect = 0.062 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP PPPP PPP PPP G Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFG 629 Score = 33.1 bits (72), Expect = 0.33 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXR 71 PPPP PPPP G G GPPP P P R Sbjct: 729 PPPPLSKTPVPPPPPGL-GRGTSSGPPPLGAKGSNAPPPPPPAGR 772 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 6/38 (15%) Frame = -1 Query: 205 PPPPXXXXGA------PPPPXXXXGGGXXGGPPPXPPP 110 PPPP A PPPP G GPP PPP Sbjct: 645 PPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPP 682 Score = 32.3 bits (70), Expect = 0.58 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP PPPP PPP PPP G Sbjct: 639 PPPPP-----PPPPPTRIPAAKCAPPPPPPPPTSHSG 670 Score = 32.3 bits (70), Expect = 0.58 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP 123 PPPP PPP G G GPPP Sbjct: 728 PPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = -1 Query: 205 PPPPXXXXG----APPPPXXXXGGGXXGGPPPXPPP--XXXGGPXFXPXXRXVIPP 56 PPPP P PP G PPP PPP P P + +PP Sbjct: 685 PPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPP 740 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP G PP PPP P P + PP Sbjct: 618 PPPPP-----PPPPSFGSTGNKRQAQPPPPPPPPP--PTRIPAAKCAPPP 660 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP F PPP Sbjct: 483 PPPPPPPPPLFTSTTSFSPSQPPPPPPP 510 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP F PPP Sbjct: 504 PPPPPPPPPLFMSTTSFSPSQPPPPPPP 531 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP G PP PPP Sbjct: 618 PPPPP-----PPPPSFGSTGNKRQAQPPPPPPP 645 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 6/44 (13%) Frame = -3 Query: 206 PPPPXXXXGX------PPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP G GPP PPP P Sbjct: 645 PPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPP 688 Score = 29.1 bits (62), Expect = 5.4 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPPXXP 558 PP P PPP + + PPPP P Sbjct: 596 PPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 28.7 bits (61), Expect = 7.1 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 3/69 (4%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGG---PPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLT 35 PPPP PPPP PPP PPP F P PP L T Sbjct: 482 PPPPPP----PPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPL-FT 536 Query: 34 AXPSXSXVQ 8 + S S Q Sbjct: 537 STTSFSPSQ 545 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPPXXP 558 PP P PPP PPPP P Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPP 624 Score = 28.3 bits (60), Expect = 9.4 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXXGXP--PPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP G PPP G G PPP PPP G Sbjct: 740 PPPPGLGRGTSSGPPP---LGAKGSNAPPP--PPPAGRG 773 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 35.1 bits (77), Expect = 0.082 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP G G G PP PPPP GGGG GGGG Sbjct: 11 PPRRGYGGRGRSPP-PPPPRRGYGGGG------GGGG 40 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 PP GG G PP PPP GGGG GGGG Sbjct: 11 PPRRGYGGRGRSPP-PPPPRRGYGGGG------GGGG 40 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 35.1 bits (77), Expect = 0.082 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPP-------XPPPXXXGGPXFXP 80 PPPP APPPP G PPP PPP GGP P Sbjct: 252 PPPPHIGGSAPPPPHM----GGSAPPPPHMGQNYGPPPPNNMGGPRHPP 296 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPPP PPP GG P PP GGP PP+ G Sbjct: 272 PPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPPPNYG 324 Score = 32.7 bits (71), Expect = 0.44 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP----XXPPPXXGGPXFXP 81 PPP G PPPP GG PPP PPP G + P Sbjct: 241 PPPQRPPMGGPPPPPHI---GGSAPPPPHMGGSAPPPPHMGQNYGP 283 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP--XXGGP 93 PPPP PPP GG PPP PP GGP Sbjct: 272 PPPPHMGQNYGPPPPNNM--GGPRHPPPYGAPPQNNMGGP 309 Score = 30.3 bits (65), Expect = 2.3 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 P PP G PPP G PPP GGP P V PP G Sbjct: 309 PRPPQNYGGTPPP--NYGGAPPANNMGGAPPPNYGGGP--PPQYGAVPPPQYG 357 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 7/43 (16%) Frame = -3 Query: 203 PPPXXXXGXP--PPPXXXXGGGGXGGPPP-----XXPPPXXGG 96 PPP G P PPP GGP P PPP GG Sbjct: 283 PPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPPPNYGG 325 Score = 29.1 bits (62), Expect = 5.4 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 13/50 (26%) Frame = -3 Query: 206 PPPPXXXXGXPP------PPXXXXGGGG----XGGPPP---XXPPPXXGG 96 P PP G PP PP GG GGPPP PPP GG Sbjct: 309 PRPPQNYGGTPPPNYGGAPPANNMGGAPPPNYGGGPPPQYGAVPPPQYGG 358 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPP----XPPPXXXGGP 92 PP GAPPP GGPPP PPP G P Sbjct: 327 PPANNMGGAPPP-------NYGGGPPPQYGAVPPPQYGGAP 360 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP P GP + + PP Sbjct: 24 PPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPP 73 Score = 30.3 bits (65), Expect = 2.3 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP---XXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP GP + P + +P P Sbjct: 24 PPPPSLPPPVPPPPPSHQP---YSYPPPPPPPPHAYYQQGPHY-PQFNQLQAPPPPP 76 Score = 28.7 bits (61), Expect = 7.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 P PP APPPP PPP PPP P P Sbjct: 12 PQPPSQNSLAPPPPPPSL-------PPPVPPPPPSHQPYSYP 46 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/74 (27%), Positives = 22/74 (29%), Gaps = 2/74 (2%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP K PPPP +PPPP PPP Sbjct: 471 PPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPP 530 Query: 121 XP--PPXXXGGPXF 86 P PP P + Sbjct: 531 PPLSPPPPSPPPPY 544 Score = 32.7 bits (71), Expect = 0.44 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGG--GXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PPP P + SP P Sbjct: 503 PPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 5/63 (7%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP---PPXXGGPXFXPXXXE--XNSPXXGPX 42 PPPP PPP PPP P PP P P SP P Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPV 666 Query: 41 AYS 33 YS Sbjct: 667 YYS 669 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP G PP PPP Sbjct: 49 PPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPPP PPPP G PP PP Sbjct: 49 PPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP G PPP Sbjct: 52 PPPPPPPPPPPPPAVNMSVETGIPPPPP 79 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP--PPXXGGPXFXP 81 PPP G PPP G GPPP P PP G P F P Sbjct: 201 PPPGGMMRGPPPP-------HGMQGPPPSRPGMPPPGGAPMFAP 237 Score = 32.3 bits (70), Expect = 0.58 Identities = 21/59 (35%), Positives = 23/59 (38%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPP G P GG GP PPP GP P R +PP G + A P Sbjct: 186 PPPPQYGGQQRPMMIPPPGGMMRGP---PPPHGMQGP---PPSRPGMPPPGGAPMFAPP 238 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 P PP G PPPP G P P PPP GG Sbjct: 163 PQPPFAGQGGPPPPY------GMRPPYPGPPPPQYGG 193 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 P PP G PPPP P P PPP GG +IPP G+ Sbjct: 163 PQPPFAGQGGPPPPYGMR------PPYPGPPPPQYGG----QQRPMMIPPPGGM 206 >At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 366 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 688 GGGGXGXGGXXPPPPXXPPXXXP 620 GGGG G GG PPPP P P Sbjct: 280 GGGGNGYGGLVPPPPPPPMMVPP 302 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 33.5 bits (73), Expect = 0.25 Identities = 19/57 (33%), Positives = 22/57 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLT 35 PPPP APPPP PPP PPP P + + P +K T Sbjct: 33 PPPPLMRRRAPPPPPPPL--MRRRAPPPPPPPPLPRPCSRPPKTKCSLKPLHWVKKT 87 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP AP PP PPP PPP Sbjct: 18 PPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPP 49 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP PPP PPP Sbjct: 33 PPPPLMRRRAPPPPPPPL--MRRRAPPPPPPPP 63 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 233 PPPPPPP 253 PPPPPPP Sbjct: 30 PPPPPPP 36 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 236 PPPPPPP 256 PPPPPPP Sbjct: 43 PPPPPPP 49 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPP-PXXXXGGGGXGGPPPXXPP 111 PPPP G PPP P GG P P PP Sbjct: 220 PPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 33.1 bits (72), Expect = 0.33 Identities = 21/61 (34%), Positives = 24/61 (39%), Gaps = 5/61 (8%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPP----XPPPXXXGGPXFXP-XXRXVIPPSRGLKLTAXPSXSXV 11 PPPP G GPPP PPP GP R +IPP G+ P + Sbjct: 167 PPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGM 226 Query: 10 Q 8 Q Sbjct: 227 Q 227 Score = 33.1 bits (72), Expect = 0.33 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP--PPXXGG 96 PPP G PPPP G GPPP P PP GG Sbjct: 210 PPPGGMMRGPPPPPH------GMQGPPPPRPGMPPAPGG 242 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = -3 Query: 203 PPPXXXXGXPPP-----PXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP P GG GPPP PP GP Sbjct: 190 PPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPP--PPHGMQGP 229 Score = 30.3 bits (65), Expect = 2.3 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXP-PPXXXGGPXFXPXXRXVIPP 56 PPP PPPP G G PPP P P GG F P R +PP Sbjct: 210 PPPGGMMRGPPPPPH----GMQGPPPPRPGMPPAPGG--FAP-PRPGMPP 252 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP--PP 110 PPPP PPPP G PP P PP Sbjct: 219 PPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -3 Query: 206 PPPPXXXXGXPPP-PXXXXGGGGXGGPPPXXPP 111 PPPP G PPP P GG P P PP Sbjct: 220 PPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 33.1 bits (72), Expect = 0.33 Identities = 21/61 (34%), Positives = 24/61 (39%), Gaps = 5/61 (8%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPP----XPPPXXXGGPXFXP-XXRXVIPPSRGLKLTAXPSXSXV 11 PPPP G GPPP PPP GP R +IPP G+ P + Sbjct: 167 PPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGM 226 Query: 10 Q 8 Q Sbjct: 227 Q 227 Score = 33.1 bits (72), Expect = 0.33 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXP--PPXXGG 96 PPP G PPPP G GPPP P PP GG Sbjct: 210 PPPGGMMRGPPPPPH------GMQGPPPPRPGMPPAPGG 242 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = -3 Query: 203 PPPXXXXGXPPP-----PXXXXGGGGXGGPPPXXPPPXXGGP 93 PPP G PPP P GG GPPP PP GP Sbjct: 190 PPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPP--PPHGMQGP 229 Score = 30.3 bits (65), Expect = 2.3 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXP-PPXXXGGPXFXPXXRXVIPP 56 PPP PPPP G G PPP P P GG F P R +PP Sbjct: 210 PPPGGMMRGPPPPPH----GMQGPPPPRPGMPPAPGG--FAP-PRPGMPP 252 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP--PP 110 PPPP PPPP G PP P PP Sbjct: 219 PPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGG----GGAPXXXXGGGG 206 PP GGG P PPP GG GAP GGGG Sbjct: 123 PPPIRGGGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGGGG 163 Score = 32.3 bits (70), Expect = 0.58 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGG----GGAPXXXXGGGG 206 PP GGG P PPP GG GAP GGGG Sbjct: 155 PPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGG 195 Score = 32.3 bits (70), Expect = 0.58 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGG----GGAPXXXXGGGG 206 PP GGG P PPP GG GAP GGGG Sbjct: 187 PPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGG 227 Score = 31.9 bits (69), Expect = 0.77 Identities = 27/99 (27%), Positives = 28/99 (28%), Gaps = 9/99 (9%) Frame = -1 Query: 316 GGGGXP-----PPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPP----PP 164 GGGG P PPP PPP G P P Sbjct: 176 GGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAP 235 Query: 163 XXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 GGG P PPP GG +PP RG Sbjct: 236 LPKRGGGGESVVPGAPPPKRGGGVIVNGGCE-TVPPGRG 273 Score = 31.5 bits (68), Expect = 1.0 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -1 Query: 316 GGGGXP-----PPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAP-----PP 167 GGGG P PPP PPP G P PP Sbjct: 97 GGGGEPVIPGAPPPNRGGGETVIPGAPPPIRGGGGEPAIPGAPPPKRGGGGEPVIPGAPP 156 Query: 166 PXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 P GGG P PPP GG P PP RG Sbjct: 157 PKR--GGGGEPVIPGAPPPKRGGGG--EPVIPGAPPPKRG 192 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP--PXXPPPXXGG 96 PPP G P P G GG P P PPP GG Sbjct: 171 PPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGG 209 Score = 30.3 bits (65), Expect = 2.3 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = -1 Query: 205 PPPPXXXXGAP-----PPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 PPP G P PPP GGG P PPP GG P PP RG Sbjct: 155 PPPKRGGGGEPVIPGAPPPKR--GGGGEPVIPGAPPPKRGGGG--EPVIPGAPPPKRG 208 Score = 28.7 bits (61), Expect = 7.1 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGG----GGAPXXXXGGGG 206 PP GGG P PPP GG GAP GGGG Sbjct: 108 PPPNRGGGETV-IPGAPPPIRGGGGEPAIPGAPPPKRGGGG 147 Score = 28.3 bits (60), Expect = 9.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP GGG G P P P GGGG P Sbjct: 140 PPKRGGG---GEPVIPGAPPPKRGGGGEP 165 Score = 28.3 bits (60), Expect = 9.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP GGG G P P P GGGG P Sbjct: 172 PPKRGGG---GEPVIPGAPPPKRGGGGEP 197 Score = 28.3 bits (60), Expect = 9.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXP 183 PP GGG G P P P GGGG P Sbjct: 204 PPKRGGG---GEPVIPGAPPPKRGGGGEP 229 Score = 28.3 bits (60), Expect = 9.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G G G GGG GGGGAP GGGG Sbjct: 415 GIGGGGGGEQGTGVGGGGDTCTQ--VTHGGGGAPLTMIGGGG 454 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGGP GGGG GGGG Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 32.7 bits (71), Expect = 0.44 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG P GGGG GGGG Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 691 GGGGGXGXGGXXPPPPXXPPXXXP 620 GGGGG G GG PP P P Sbjct: 127 GGGGGGGGGGGGGPPKMVIPQLTP 150 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGGP GGGG GGGG Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 32.7 bits (71), Expect = 0.44 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG P GGGG GGGG Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 32.3 bits (70), Expect = 0.58 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +3 Query: 57 GGITFLXXGXKXGPPXXXGGGXGGGPPXX---PPPXXXXGGGGAPXXXXGGGG 206 GG + G G GGG GGG P PP GGGG GGGG Sbjct: 371 GGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGG-----GGGG 418 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGP--PXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GG P GGGG P GGGG Sbjct: 330 GGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGG 373 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 109 GGGXXGG-GPPXPPPPXXXXGGGGXPXXXXGGGG 207 GGG GG G P GGGG P GGGG Sbjct: 340 GGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGG 373 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 94 GPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 GP GG G G P P GG G GGGG Sbjct: 293 GPGPAGGKIEGKGMPFPVQMGGGGGGPGGKKGGPGGGG 330 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 691 GGGGGXGXGGXXPPPPXXPPXXXP 620 GGGGG G GG PP P P Sbjct: 127 GGGGGGGGGGGGGPPKMVIPQLTP 150 >At3g04610.1 68416.m00493 KH domain-containing protein similar putative nucleic acid binding protein GB:CAB39665 [Arabidopsis thaliana]; Pfam HMM hit: KH domain family of RNA binding proteins Length = 577 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXG-GPPPXXPPPXXGGPXFXP 81 PPP G P GGGG G PPP PP + P Sbjct: 377 PPPHQSWGPPQGHAPSVGGGGYGHNPPPYMQPPPRHDSYYPP 418 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PPP PPP P P Sbjct: 559 PPPPVY--SSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP +PPPP PPP PP P P Sbjct: 559 PPPPVY--SSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 29.5 bits (63), Expect = 4.1 Identities = 19/82 (23%), Positives = 20/82 (24%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP PP P +PPPP PPP Sbjct: 552 PPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPP 611 Query: 121 XPPPXXXGGPXFXPXXRXVIPP 56 P P P PP Sbjct: 612 PSPVYSPPPPSHSPPPPVYSPP 633 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 32.3 bits (70), Expect = 0.58 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP-PXXXGGPXFXPXXRXVIPPS 53 PPPP PPPP PPP PP P P P PPS Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPS 439 Score = 32.3 bits (70), Expect = 0.58 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PPP PP P P P P Sbjct: 404 PPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYP 457 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAY 36 PPPP PPPP PPP PPP P + P P Y Sbjct: 379 PPPPPPPPPPPPPPP----------PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVY 425 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 32.3 bits (70), Expect = 0.58 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP + P P GPPP PPP Sbjct: 576 PPPPISSLRSTPSPSSTSNSIATQGPPPPPPP 607 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP P P GPPP PPP Sbjct: 576 PPPPISSLRSTPSPSSTSNSIATQGPPPPPPPP 608 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 32.3 bits (70), Expect = 0.58 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 46 GPXXGELXSXLXGXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGG 204 GP G GP GGG G G P P GGGG P G G Sbjct: 61 GPGFGPRGPGPWSGPRGPRPGGGGGPGPG-PWSGPRGPRPGGGGGPGSGCGSG 112 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 93 GPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 GP GGG G G P P GGGG P G G Sbjct: 77 GPRPGGGGGPGPG-PWSGPRGPRPGGGGGPGSGCGSG 112 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 32.3 bits (70), Expect = 0.58 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP---XXGGPXFXPXXXEXNSP 57 PPPP PPPP PPP PPP P P NSP Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSP--PPPDAPPPIPIVFPPPIDSPPPESTNSP 118 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSP 57 PPPP PPPP PPP PP P P + + P Sbjct: 118 PPPPEVFE--PPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHP 165 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 32.3 bits (70), Expect = 0.58 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPP PPP PPP P P Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPP PPPP PP PPP P P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 29.1 bits (62), Expect = 5.4 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPS 53 PPPP PPPP PPP PPP P P + PP+ Sbjct: 62 PPPP------PPPPCPPPPSPPPCPPPPSPPPSPP--PPQLPPPPQLPPPA 104 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGL 44 PPPP PPP PPP PP P P + PP+ L Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP-SPPTPDL 117 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP APP P PPP PP Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPPPP 737 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PP P PPP PPP P +SP P Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPP--PPPPPPPPAPPTPQSNGISAMKSSPPAPP 758 Score = 29.5 bits (63), Expect = 4.1 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP APP P PP P P P PP L T P Sbjct: 729 PPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPP-PTAPPPPPLGQTRAP 787 Query: 25 S 23 S Sbjct: 788 S 788 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = -3 Query: 176 PPPPXXXX---GGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPP PPP GGP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPP 404 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 P P PP P G GGP P PPP GP P Sbjct: 375 PAPQMPSSAGPPRPPPPAPPPGSGGPKP-PPPPGPKGPRPPP 415 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP G G GP P PPP G Sbjct: 388 PPPPAPPPGSG---GPKPPPPPGPKG 410 Score = 28.7 bits (61), Expect = 7.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 130 GPPXPPPPXXXXGGGG 177 GPP PPPP G GG Sbjct: 384 GPPRPPPPAPPPGSGG 399 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPP PPP G G PPP Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 28.3 bits (60), Expect = 9.4 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = -1 Query: 178 APPPPXXXXGGGXXGGPP---PXPPPXXXGGPXFXP 80 APPPP GPP P PP GGP P Sbjct: 369 APPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPP 404 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = -3 Query: 176 PPPPXXXX---GGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP G PPP PPP GGP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPP 404 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 P P PP P G GGP P PPP GP P Sbjct: 375 PAPQMPSSAGPPRPPPPAPPPGSGGPKP-PPPPGPKGPRPPP 415 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP G G GP P PPP G Sbjct: 388 PPPPAPPPGSG---GPKPPPPPGPKG 410 Score = 28.7 bits (61), Expect = 7.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 130 GPPXPPPPXXXXGGGG 177 GPP PPPP G GG Sbjct: 384 GPPRPPPPAPPPGSGG 399 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPP PPP G G PPP Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 28.3 bits (60), Expect = 9.4 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = -1 Query: 178 APPPPXXXXGGGXXGGPP---PXPPPXXXGGPXFXP 80 APPPP GPP P PP GGP P Sbjct: 369 APPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPP 404 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGP---PPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP P P PPP P P V+PP Sbjct: 34 PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPP 86 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = -1 Query: 205 PPPPXXXXGA--PPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPPP G PPPP PP PPP G Sbjct: 194 PPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYG 231 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/60 (30%), Positives = 22/60 (36%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP +PPPP P PPP P P + PP + L+ P Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPP---PPPVNLSPPPPPVLLSPPP 100 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/60 (30%), Positives = 21/60 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP PPPP P PPP P P + PP + L+ P Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPP---PPPVLLSPPPPPVNLSPPP 145 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP 116 PPPP +PPPP PPP P Sbjct: 169 PPPPPTITRSPPPPRPQAAAYYKKTPPPPP 198 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXP 81 PPPP PPPP PP PPP G + P Sbjct: 169 PPPPPTITRSPPPPRPQAAAYYKKTPP---PPPYKYGRVYPP 207 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = -3 Query: 206 PPPPXXXXGX--PPPPXXXXGGGGXGGPPPXXPPPXXG 99 PPPP G PPPP PP PP G Sbjct: 194 PPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYG 231 >At4g23882.1 68417.m03434 heavy-metal-associated domain-containing protein Length = 284 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP G PPPP G G PP PP Sbjct: 242 PPPSFFPGRPPPPYT--GAGMFQSAPPQSPP 270 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPP 111 PPP G PPPP G G PP PP Sbjct: 242 PPPSFFPGRPPPP--YTGAGMFQSAPPQSPP 270 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP GP P P P P SP GP Sbjct: 165 PPPPPYPSPLPPPPSPSP----TPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGP 214 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP PPP PPP Sbjct: 314 PPPPPPLLQQPPPPPSVSKAPPP--PPPPPPP 343 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP PPP PPP Sbjct: 314 PPPPPPLLQQPPPPPSV----SKAPPPPPPPPP 342 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 7/49 (14%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPP-------XPPPXXXGGPXFXP 80 PPPP A PPP GGG PP PPP G + P Sbjct: 56 PPPPSPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPPPSSSSGGYYYP 104 Score = 29.5 bits (63), Expect = 4.1 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 8/62 (12%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP------XXPPP--XXGGPXFXPXXXEXNSPXX 51 PPPP PPP GGG PP PPP GG + P N P Sbjct: 56 PPPPSPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPPPSSSSGGYYYPPPKSGGNYPYT 115 Query: 50 GP 45 P Sbjct: 116 PP 117 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 31.1 bits (67), Expect = 1.3 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 14/67 (20%) Frame = -3 Query: 203 PPPXXXXGXP----PPPXXXXGGGGXGGPPP---------XXPPPXXGGPXFXPXXXEXN 63 PPP G P PPP GG GPPP PPP GP P + Sbjct: 182 PPPSGMPGGPLSNGPPPSGMHGGHLSNGPPPSGMPGGPLSNGPPPPMMGPGAFPRGSQFT 241 Query: 62 S-PXXGP 45 S P P Sbjct: 242 SGPMMAP 248 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPP + PPP GG GPPP Sbjct: 172 PPPMGPGMSMPPPSGMPGGPLSNGPPP 198 Score = 29.5 bits (63), Expect = 4.1 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXPS 23 P P G PPP GGPP P GG F P R V PPS PS Sbjct: 80 PSPMARPGPPPPAAM----ARPGGPPQVSQP---GG--FPPVGRPVAPPSNQPPFGGRPS 130 Score = 29.1 bits (62), Expect = 5.4 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 8/64 (12%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPP--------XXPPPXXGGPXFXPXXXEXNSPXXG 48 PPP PPP GG GPPP PP G P P P G Sbjct: 172 PPPMGPGMSMPPPSGMPGGPLSNGPPPSGMHGGHLSNGPPPSGMPG-GPLSNGPPPPMMG 230 Query: 47 PXAY 36 P A+ Sbjct: 231 PGAF 234 Score = 29.1 bits (62), Expect = 5.4 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP G P G PPP PP G NSP P A+S Sbjct: 224 PPPPMMGPGAFPRGSQFTSGPMMAPPPPYGQPPNAG-------PFTGNSPLSSPPAHS 274 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = -1 Query: 205 PPP----PXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXG 98 PPP P PPPP GGP P PPP G Sbjct: 283 PPPMQFRPPQGMPPPPPPQFLNHQQGFGGPRPPPPPQAMG 322 Score = 25.8 bits (54), Expect(2) = 8.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 239 PPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPP F GG PPP Sbjct: 295 PPPPPPQFLNHQQGF----GGPRPPP 316 Score = 21.0 bits (42), Expect(2) = 8.2 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 233 PPPPPP 250 PPPPPP Sbjct: 257 PPPPPP 262 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYSXT 27 PPPP PPPP PPP PP P + P SP P YS Sbjct: 616 PPPPPPVHS-PPPPVFSPPPPVHSPPPPVYSPPP---PVYSPPPPPVKSPPP-PPVYSPP 670 Query: 26 XL 21 L Sbjct: 671 LL 672 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP--XXPPPXXGGP 93 PPPP PPPP PPP PPP P Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 566 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = -1 Query: 205 PPPPXXXXGAP---PPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP P PPP PPP PP P F P PP Sbjct: 588 PPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPP 640 Score = 29.1 bits (62), Expect = 5.4 Identities = 20/70 (28%), Positives = 26/70 (37%), Gaps = 6/70 (8%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPP--XPPPXXXGGP----XFXPXXRXVIPPSRGLK 41 PPP +PPPP PPP PPP P P PP K Sbjct: 616 PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPK 675 Query: 40 LTAXPSXSXV 11 +++ P+ + V Sbjct: 676 MSSPPTQTPV 685 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PPPP PPPP PP PPP P P P P Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPP--PPPPVYSPPPPPPVHSPPPPVHSP 552 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP PP P PPP PP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPP 523 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 205 PPPPXXXXGA-PPPPXXXXGGGXXGGPPPXPPPXXXGG 95 PPPP A PPPP GG G PPP GG Sbjct: 55 PPPPSTPTTACPPPPSPPSSGG--GSSYYYPPPSQSGG 90 Score = 28.7 bits (61), Expect = 7.1 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 12/66 (18%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGG---PPP-------XXPPPXXGG--PXFXPXXXEXN 63 PPPP PPP GG PPP PPP GG + P N Sbjct: 55 PPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYYPPPYSGN 114 Query: 62 SPXXGP 45 P P Sbjct: 115 YPTPPP 120 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 PP GGG PP GGG GGGG Sbjct: 66 PPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGG 102 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -1 Query: 205 PPPPXXXXGAP--PPPXXXXGGGXXGGPPPXPPP 110 PPPP AP PPP PPP PPP Sbjct: 43 PPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPP 76 Score = 23.8 bits (49), Expect(2) = 4.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 233 PPPPPPP 253 PPPPPPP Sbjct: 41 PPPPPPP 47 Score = 23.8 bits (49), Expect(2) = 4.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 236 PPPPPPP 256 PPPPPPP Sbjct: 70 PPPPPPP 76 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 G G P GG GGG P GGG P GGG Sbjct: 325 GGMGGMPGGFPGGMGGGMPAGMGGGMPGMGGGMPAGMGGGG 365 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/60 (28%), Positives = 21/60 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 P PP +PPPP PP PP P P +PP G+ + P Sbjct: 781 PSPPVYYYNSPPPPPAVHYS------PPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPP 834 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PP P P PP Sbjct: 758 PPPPPTVHYNPPPPP----SPAHYSPPPSPPVYYYNSPPPPPAVHYSPPP 803 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP PPP PPP Sbjct: 64 PPPPPPT--SPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPP PPP PPP PPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = -1 Query: 205 PPPPXXXXGA--PPPPXXXXGGGXXGGPPP---XPPPXXXGGPXFXPXXRXVIPP 56 PPPP PPPP PPP PPP P + P + PP Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPP 96 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/57 (31%), Positives = 21/57 (36%), Gaps = 5/57 (8%) Frame = -1 Query: 205 PPPPXXXXGA--PPPPXXXXGGGXXGGPPPX---PPPXXXGGPXFXPXXRXVIPPSR 50 PPPP PPPP PPP PPP P + P + PP + Sbjct: 55 PPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPPK 111 Score = 29.1 bits (62), Expect = 5.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP PPPP PPP PPP P Sbjct: 67 PPPPPIYS--PPPPPIYPPPIYSPPPPPIYPPPIYSPP 102 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP AP PP G PPP PP Sbjct: 26 PPPPPMRRSAPSPPPM---SGRVPPPPPPPP 53 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 P P G P PP G G PPP PPP Sbjct: 628 PLPRLVRVGSPSPPPPSMSG---GAPPPPPPPP 657 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP 116 P P GAPPP GG PPP P Sbjct: 688 PLPLLVREGAPPPTLPSMSGGAPPPPPPLP 717 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -1 Query: 205 PPPPXXXXGAPPPP 164 PPPP GAPPPP Sbjct: 640 PPPPSMSGGAPPPP 653 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP 116 P P G+P PP GG PPP P Sbjct: 628 PLPRLVRVGSPSPPPPSMSGGAPPPPPPPP 657 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 30.3 bits (65), Expect = 2.3 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP-PXXXGGPXFXPXXRXVIPP 56 PPPP PP G G GGPP P P GGP P + PP Sbjct: 127 PPPPQNGILRPPGMAPIPGQG--GGPPGMAPIPGQGGGP--PPNYNGLPPP 173 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGG 96 PPPP PP G GG GPP P P GG Sbjct: 127 PPPPQNGILRPPGMAPIPGQGG--GPPGMAPIPGQGG 161 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/59 (30%), Positives = 22/59 (37%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPP +PPPP PPP PP P P +PP G+ + P Sbjct: 436 PPPSPPVYSPPPPPSIH----YSSPPP-PPVHHSSPPPPSPEFEGPLPPVIGVSYASPP 489 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPPP PPP PPP PP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPP 441 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPP---XPPPXXXGGP 92 PPPP PPPP PPP PPP P Sbjct: 742 PPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPP 782 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP--XXPPPXXGGP 93 PPPP PPPP PPP PPP P Sbjct: 742 PPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSP 781 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = -1 Query: 205 PPPPXXXXGAP---PPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIP 59 PPPP P PPP PPP P P F P + V P Sbjct: 774 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTP 825 Score = 28.3 bits (60), Expect = 9.4 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPP--XPPPXXXGGP 92 PPP +PPPP PPP PPP P Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPP 685 Score = 28.3 bits (60), Expect = 9.4 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPP---XPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PPP PPP P P PP Sbjct: 706 PPPPVH---SPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G G GGG GGP GGGG P GGG Sbjct: 265 GGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGG 306 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 57 GGITFLXXGXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GG G K GP GG G P GGGG P G G Sbjct: 269 GGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNG 318 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 82 GXXXGPPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 G G GG GGP GGGG P GGG Sbjct: 265 GGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGG 306 >At2g47700.1 68415.m05957 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type(RING finger) Length = 358 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXP 310 PPPPPPPP F GG P Sbjct: 300 PPPPPPPPMPDQNVGFFIYPGGHHEP 325 >At1g70470.1 68414.m08108 expressed protein Length = 154 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 691 GGGGGXGXGGXXPPP 647 GGGGG G GG PPP Sbjct: 137 GGGGGGGKGGKRPPP 151 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PPP G PPPP G PP PP P N GP A Sbjct: 193 PPPNQGMGGAPPPPPHI--GNNPNMPPHIQPPNMNQNYRGPPPPPNMNQNYQGPPA 246 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP GAPPPP G PP PP Sbjct: 193 PPPNQGMGGAPPPPPHI--GNNPNMPPHIQPP 222 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 12/43 (27%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXG------------GPPPXPPP 110 PPP G PPP GG G GPPP PPP Sbjct: 45 PPPQPYGGYPPPSSRPYEGGYQGYFAGGGYPHQHHGPPPPPPP 87 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 29.9 bits (64), Expect = 3.1 Identities = 22/54 (40%), Positives = 23/54 (42%) Frame = +3 Query: 45 RPLXGGITFLXXGXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 R GG F G + G P GGG GGG P GGGG P G GG Sbjct: 98 RRFGGGRRF---GGRFGKPG--GGGLGGG--GLPGGLGGLGGGGLPGGLGGLGG 144 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPP +PPPP PP PPP P P PP Sbjct: 55 PPPSPYLYSSPPPPPYVYNS------PPPPPPYIYNSPPRPPYVYKSPPP 98 Score = 28.3 bits (60), Expect = 9.4 Identities = 14/42 (33%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGP----PPXPPPXXXGGP 92 PPPP +PPPP P P PPP P Sbjct: 65 PPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSP 106 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPPP PPPP PPP PPP GP Sbjct: 9 PPPP------PPPPPRLLVLPPLPPPPPPPPPQLPFGP 40 >At3g10300.3 68416.m01236 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 335 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXG 197 PP G G GG PP PP G P G Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSG 38 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXG 198 PP G GG PP P PP G P G Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSG 38 >At3g10300.2 68416.m01235 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 324 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXG 197 PP G G GG PP PP G P G Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSG 38 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXG 198 PP G GG PP P PP G P G Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSG 38 >At3g10300.1 68416.m01234 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 232 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXG 197 PP G G GG PP PP G P G Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSG 38 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXG 198 PP G GG PP P PP G P G Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSG 38 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 96 PPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 PP G GGG P GGGG GGGG Sbjct: 94 PPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGG 130 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 97 PPXXGGGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 PP G GGG P GGGG GGGG Sbjct: 94 PPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGG 130 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG P G GA GGGG Sbjct: 104 GGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGG 135 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAY 36 PPPP PPPP P PPP P P SP P Y Sbjct: 330 PPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKP---PPYVYNYSPPPAPYVY 383 Score = 29.5 bits (63), Expect = 4.1 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PP P P SP P YS Sbjct: 70 PPPPPYVYSSPPPPPYV-----YNSPPP--PPYVYSSP--PPPPYVYKSPPPPPYVYS 118 Score = 29.1 bits (62), Expect = 5.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P PPP P P PP Sbjct: 70 PPPPPYVYSSPPPPPYVYNS-------PPPPPYVYSSPPPPPYVYKSPPP 112 Score = 28.7 bits (61), Expect = 7.1 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP-----PXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PP P PPP P P PP Sbjct: 110 PPPPPYVYSSPPPPPYVYKSPPP--PPYVYSSPPPPPYVYSSPPPPPYVYKSPPP 162 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PP P P SP P YS Sbjct: 160 PPPPPYVYSPPPPPPYV-----YQSPPP--PPYVYSSP--PPPPYVYKSPPPPPYVYS 208 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PP P P SP P YS Sbjct: 200 PPPPPYVYSSPPPPPYV-----YKSPPP--PPYVYSSP--PPPPYVYKSPPPPPYVYS 248 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PP P P SP P YS Sbjct: 240 PPPPPYVYSSPPPPPYV-----YKSPPP--PPYVYSSP--PPPPYVYKSPPPPPYVYS 288 Score = 28.7 bits (61), Expect = 7.1 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP-----PXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PP P PPP P P PP Sbjct: 260 PPPPPYVYSSPPPPPYVYKSPPP--PPYVYSSPPPPPYVYSSPPPPPYVYSSPPP 312 Score = 28.7 bits (61), Expect = 7.1 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPP-----PXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP PP P PPP P P PP Sbjct: 300 PPPPPYVYSSPPPPPYVYKSPPP--PPYVYTSPPPPPYVYKSPPPPPYVDSYSPP 352 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P PPP P P PP Sbjct: 180 PPPPPYVYSSPPPPPYVY-------KSPPPPPYVYSSPPPPPYVYKSPPP 222 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P PPP P P PP Sbjct: 220 PPPPPYVYSSPPPPPYVY-------KSPPPPPYVYSSPPPPPYVYKSPPP 262 Score = 28.3 bits (60), Expect = 9.4 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PP P P SP P Y+ Sbjct: 280 PPPPPYVYSSPPPPPYV-----YSSPPP--PPYVYSSP--PPPPYVYKSPPPPPYVYT 328 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/60 (31%), Positives = 23/60 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLTAXP 26 PPPP +PPPP PP PPP + P PP+ L +T P Sbjct: 59 PPPPSPPPPSPPPPACPP-------PPALPPPPPKKVSSYCPPP----PPANFLYITGPP 107 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPPP PPP PPP Sbjct: 59 PPPPSPPPPSPPPPACP--------PPPALPPP 83 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 7/45 (15%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGG-------GGXGGPPPXXPPPXXGGP 93 PPPP PP P G G GPPP PP GP Sbjct: 356 PPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLPPGP 400 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPP 567 PP P PPP T K PPPP Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPP 117 Score = 29.1 bits (62), Expect = 5.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPP 567 PP P PPP T K PPPP Sbjct: 106 PPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPPXXPK 555 PP P PPP T K PPP P+ Sbjct: 130 PPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPE 161 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -3 Query: 650 PPXPXXXXPPPXTXKKXKXXXXGXPPPPXXP 558 PP P PPP K PPPP P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTP 127 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 233 PPPPPPPPXXXXXXXXFXXGGGGXXPPP 316 PPPPPPPP G PPP Sbjct: 155 PPPPPPPPTITPPVTTTTTGHHHHRPPP 182 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 PPPP PP G PP PPP P P Sbjct: 125 PPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITP 166 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXG 134 PPPP +PPPP GG G Sbjct: 269 PPPPGSWQPSPPPPPPPVSGGMNG 292 >At3g08530.1 68416.m00990 clathrin heavy chain, putative similar to Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo sapiens] Length = 1703 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPP 123 P PP GGGG GPPP Sbjct: 1664 PAPPMPGMGGGGGYGPPP 1681 Score = 28.7 bits (61), Expect = 7.1 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 175 PPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRG 47 P PP GGG G PPP G P P +PP G Sbjct: 1664 PAPPMPGMGGGGGYG----PPPQMGGMPGMPPMPPYGMPPMGG 1702 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 112 GGXXGGGPPXPPPPXXXXGG 171 GG GGGP PPPP G Sbjct: 223 GGWGGGGPSPPPPPRMPTSG 242 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PPP APPP PPP PP Sbjct: 100 PPPPLPTEAPPPANPVSSPPPESSPPPPPP 129 Score = 29.1 bits (62), Expect = 5.4 Identities = 16/53 (30%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -3 Query: 200 PPXXXXGXPPPPXXXXGGGGXGGP-PPXXPPPXXGGPXFXPXXXEXNSPXXGP 45 PP PPPP P PP PPP P P ++P P Sbjct: 118 PPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPP 170 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 29.5 bits (63), Expect = 4.1 Identities = 20/82 (24%), Positives = 20/82 (24%) Frame = -1 Query: 301 PPPPXXKXXXXXXXXXXXXXXXXXXXXXXXFXPPPPXXXXGAPPPPXXXXGGGXXGGPPP 122 PPPP K PPPP PPP P Sbjct: 425 PPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSP 484 Query: 121 XPPPXXXGGPXFXPXXRXVIPP 56 PPP P P PP Sbjct: 485 PPPPYVYSSPPPPPYVYSSPPP 506 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP +PPPP PPP PPP Sbjct: 504 PPPPYVYSSPPPPYVY---SSPPPPPPSPPP 531 Score = 29.1 bits (62), Expect = 5.4 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = -1 Query: 202 PPPXXXXGAPPPPXXXXGGGXXGGPPPXP---PPXXXGGPXFXP 80 PPP +PPPP PPP P PP P P Sbjct: 529 PPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSP 572 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 69 FLXXGXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 +L G G GGG GGG G GG GGGG Sbjct: 41 WLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGG 86 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 23.8 bits (49), Expect(2) = 4.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 233 PPPPPPP 253 PPPPPPP Sbjct: 69 PPPPPPP 75 Score = 23.8 bits (49), Expect(2) = 4.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 236 PPPPPPP 256 PPPPPPP Sbjct: 110 PPPPPPP 116 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 648 GGGXXPPXPXPPPPP 692 GG PP P PPPPP Sbjct: 324 GGEFHPPPPPPPPPP 338 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXG-GPPPXXPPPXXG 99 P PP PPPP GG P PPP G Sbjct: 222 PSPPRKPPPPPPPPAFMSSSGGSDYSDLPVLPPPSPG 258 >At3g11130.1 68416.m01349 clathrin heavy chain, putative similar to Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo sapiens] Length = 1705 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = -3 Query: 176 PPPPXXXXGGGGXGGPPPXXPPPXXGG-PXFXP 81 P PP GGGG G PP P G P P Sbjct: 1664 PAPPMPGMGGGGYGPPPQMGGMPGMSGMPPMPP 1696 >At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 147 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXP 80 P P +PPPP GG PPP GG + P Sbjct: 41 PCNPVPSSYSPPPPPPSSSGGGGSYYYSPPPPSSSGGVKYPP 82 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 8/48 (16%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGG--PPP------XXPPPXXGGPXF 87 PPPP G PP GG G GG PPP PPP P F Sbjct: 69 PPPPSSSGGVKYPP--PYGGDGYGGYYPPPYYGNYGTPPPPNPIVPYF 114 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 29.1 bits (62), Expect = 5.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPP 113 PP P PPPP PPP PP Sbjct: 249 PPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPP A PPP G PP PPP Sbjct: 248 PPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP + PP GP P PPP Sbjct: 247 PPPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 203 PPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPP G PP GG G PP PP Sbjct: 46 PPPPPPHGYPPVAYPPHGGYPPAGYPPAGYPP 77 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 28.7 bits (61), Expect = 7.1 Identities = 16/58 (27%), Positives = 17/58 (29%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPP G PPP P + P P YS Sbjct: 151 PPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYS 208 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 28.7 bits (61), Expect = 7.1 Identities = 16/58 (27%), Positives = 17/58 (29%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPP G PPP P + P P YS Sbjct: 133 PPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYS 190 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPP 108 PPPP PPP PPP PPP Sbjct: 391 PPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPP 423 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGP 93 PPPP P P PPP PPP P Sbjct: 153 PPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTP 190 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP--PPXXXGGPXFXP 80 PPP PP P G GG PP P P G P F P Sbjct: 140 PPPRTPVVVTPPSPIVDPGTPIIGGSPPTPIIDPGTPGTP-FIP 182 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXP--PPXXXGGPXFXP 80 PPP PP P G GG PP P P G P F P Sbjct: 140 PPPRTPVVVTPPSPIVDPGTPIIGGSPPTPIIDPGTPGTP-FIP 182 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 G K G GGG GGG GGGG GGGG Sbjct: 12 GGKGGGGGGSGGGRGGGGGGGAK--GGCGGGGKSGGGGGGGG 51 >At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLT 35 P PP P PP G PP P GG P V PPS G K T Sbjct: 155 PIPPVVGPNLPLPPLPIVGPIL----PPGTTPPATGGKDCPPPPGSVKPPSGGGKAT 207 >At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPPSRGLKLT 35 P PP P PP G PP P GG P V PPS G K T Sbjct: 155 PIPPVVGPNLPLPPLPIVGPIL----PPGTTPPATGGKDCPPPPGSVKPPSGGGKAT 207 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 111 GGGXGGGPPXXPPPXXXXGGGGAPXXXXGGGG 206 GGG GGG GGGG GGGG Sbjct: 163 GGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGG 194 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPP----XXPPPXXGGPXFXPXXXEXNSPXXGPXA 39 PPPP PPPP PPP PPP P NSP P Sbjct: 90 PPPPPYVYSSPPPPPYIYKS---PPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYV 146 Query: 38 Y 36 Y Sbjct: 147 Y 147 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PP P P SP P YS Sbjct: 190 PPPPPYVYSSPPPPPYV-----YKSPPP--PPYVYSSP--PPPPYVYKSPPPPPYVYS 238 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PP P P SP P YS Sbjct: 230 PPPPPYVYSSPPPPPYV-----YKSPPP--PPYVYSSP--PPPPYVYKSPPPPPYVYS 278 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PP P P SP P YS Sbjct: 270 PPPPPYVYSSPPPPPYV-----YKSPPP--PPYVYSSP--PPPPYVYKSPPPPPYVYS 318 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PP P P SP P YS Sbjct: 310 PPPPPYVYSSPPPPPYV-----YKSPPP--PPYVYNSP--PPPPYVYKSPPPPPYVYS 358 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PP P P SP P YS Sbjct: 370 PPPPPYVYSSPPPPPYV-----YKSPPP--PPYVYSSP--PPPPYVYKSPPPPPYVYS 418 Score = 28.3 bits (60), Expect = 9.4 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXFXPXXXEXNSPXXGPXAYS 33 PPPP PPPP PPP PP P P SP P YS Sbjct: 50 PPPPPYVYSSPPPPPYI-----YKSPPP--PPYVYSSP--PPPPYIYKSPPPPPYVYS 98 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P PPP P P PP Sbjct: 50 PPPPPYVYSSPPPPPYIY-------KSPPPPPYVYSSPPPPPYIYKSPPP 92 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P PPP P P PP Sbjct: 90 PPPPPYVYSSPPPPPYIY-------KSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P PPP P P PP Sbjct: 130 PPPPPYVYNSPPPPPYVY-------KSPPPPPYVYSSPPPPPYVYKSPPP 172 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P PPP P P PP Sbjct: 170 PPPPPYVYSSPPPPPYVY-------KSPPPPPYVYSSPPPPPYVYKSPPP 212 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P PPP P P PP Sbjct: 210 PPPPPYVYSSPPPPPYVY-------KSPPPPPYVYSSPPPPPYVYKSPPP 252 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P PPP P P PP Sbjct: 250 PPPPPYVYSSPPPPPYVY-------KSPPPPPYVYSSPPPPPYVYKSPPP 292 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P PPP P P PP Sbjct: 290 PPPPPYVYSSPPPPPYVY-------KSPPPPPYVYSSPPPPPYVYKSPPP 332 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P PPP P P PP Sbjct: 330 PPPPPYVYNSPPPPPYVY-------KSPPPPPYVYSSPPPSPYVYKSPPP 372 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPPXXXGGPXFXPXXRXVIPP 56 PPPP +PPPP P PPP P P PP Sbjct: 370 PPPPPYVYSSPPPPPYVY-------KSPPPPPYVYSSPPPPPYVYKSPPP 412 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 28.7 bits (61), Expect = 7.1 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +1 Query: 94 GPPXXGGGXX-----GGGPPXPPPPXXXXGGGGXPXXXXGGG 204 G P GGG GGG PP GGGG P GGG Sbjct: 404 GSPSPGGGSGSPPSTGGGSGSPPSTG---GGGGSPSKGGGGG 442 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 81 GXKXGPPXXXGGGXGGGPPXXPPPXXXXGGGGAPXXXXGGG 203 G G P GGG G P GGGG+P GGG Sbjct: 409 GGGSGSPPSTGGGSGS-------PPSTGGGGGSPSKGGGGG 442 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = -1 Query: 205 PPPPXXXXGAPPP-PXXXXGGGXXGGPPPXPPP 110 PPPP PPP P P P PPP Sbjct: 55 PPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPP 87 Score = 28.3 bits (60), Expect = 9.4 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPPPXXPPPXXGGPXF 87 PPPP PPPP P P PPP P + Sbjct: 55 PPPPSCTPS-PPPPSPPPPKKSSCPPSPLPPPPPPPPPNY 93 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 23.8 bits (49), Expect(2) = 7.8 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -3 Query: 206 PPPPXXXXGXPPPP 165 PPPP PPPP Sbjct: 29 PPPPPPPPPPPPPP 42 Score = 23.0 bits (47), Expect(2) = 7.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -3 Query: 131 PPPXXPPPXXGGP 93 PPP PPP GP Sbjct: 34 PPPPPPPPPRLGP 46 >At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 383 Score = 28.3 bits (60), Expect = 9.4 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP-PXXPPP 108 PPPP PPP G G PP P PPP Sbjct: 182 PPPPPHH----PPPYGGYFSGSNGQPPLPVSPPP 211 Score = 28.3 bits (60), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 633 GGXXGGGGXXPPXPXPPPPP 692 GG G PP P PPPP Sbjct: 193 GGYFSGSNGQPPLPVSPPPP 212 >At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 661 Score = 28.3 bits (60), Expect = 9.4 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -3 Query: 206 PPPPXXXXGXPPPPXXXXGGGGXGGPP-PXXPPP 108 PPPP PPP G G PP P PPP Sbjct: 182 PPPPPHH----PPPYGGYFSGSNGQPPLPVSPPP 211 Score = 28.3 bits (60), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 633 GGXXGGGGXXPPXPXPPPPP 692 GG G PP P PPPP Sbjct: 193 GGYFSGSNGQPPLPVSPPPP 212 >At3g02670.1 68416.m00258 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 217 Score = 28.3 bits (60), Expect = 9.4 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = -1 Query: 172 PPPXXXXGGGXXGGP---PPXPPPXXXGGP-XFXPXXRXVIPPSRGLKLTAXP 26 P P GGG G P PP PP G P F P IP G + P Sbjct: 158 PFPFPPSGGGIPGLPLPFPPLPPVTIPGLPLPFPPLPPVTIPSFPGFRFPPLP 210 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 28.3 bits (60), Expect = 9.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 112 GGXXGGGPPXPPPPXXXXGGGGXPXXXXGGGG 207 GG GG PP GGGG GGGG Sbjct: 172 GGNAGGYGGNPPYSGNAVGGGGGYGSNFGGGG 203 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 28.3 bits (60), Expect = 9.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = -1 Query: 205 PPPPXXXX--GAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPP G PPP PP PPP GGP Sbjct: 6 PPPQYLRPPSGPPPPTDPYHQYYQHQARPPVPPPTQPGGP 45 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 28.3 bits (60), Expect = 9.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = -1 Query: 205 PPPPXXXX--GAPPPPXXXXGGGXXGGPPPXPPPXXXGGP 92 PPP G PPP PP PPP GGP Sbjct: 6 PPPQYLRPPSGPPPPTDPYHQYYQHQARPPVPPPTQPGGP 45 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 28.3 bits (60), Expect = 9.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 205 PPPPXXXXGAPPPPXXXXGGGXXGGPPPXPPP 110 PPPP PPPP PPP PPP Sbjct: 44 PPPP------PPPPPPPLYFSYFSLPPPPPPP 69 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,851,482 Number of Sequences: 28952 Number of extensions: 403346 Number of successful extensions: 12240 Number of sequences better than 10.0: 101 Number of HSP's better than 10.0 without gapping: 831 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7847 length of database: 12,070,560 effective HSP length: 82 effective length of database: 9,696,496 effective search space used: 2724715376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -