BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_K15 (809 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 27 0.52 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 27 0.52 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 27 0.52 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 27 0.52 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 27 0.68 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 27 0.90 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 27 0.90 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 26 1.2 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 25 2.1 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 24 4.8 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 24 6.4 AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like pepti... 23 8.4 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 8.4 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 27.5 bits (58), Expect = 0.52 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = -2 Query: 751 VSSITASLRFDGALNVDLTRVPD*LGALPPYPLPHWSRTRQSSLPRRPT--HEQLSVAEI 578 +S +T LRF G LN DL ++ + P+P H+ + L R + + L+V E+ Sbjct: 129 MSGVTTCLRFPGQLNADLRKL---AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPEL 185 Query: 577 T 575 T Sbjct: 186 T 186 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 27.5 bits (58), Expect = 0.52 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = -2 Query: 751 VSSITASLRFDGALNVDLTRVPD*LGALPPYPLPHWSRTRQSSLPRRPT--HEQLSVAEI 578 +S +T LRF G LN DL ++ + P+P H+ + L R + + L+V E+ Sbjct: 129 MSGVTTCLRFPGQLNADLRKL---AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPEL 185 Query: 577 T 575 T Sbjct: 186 T 186 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 27.5 bits (58), Expect = 0.52 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = -2 Query: 751 VSSITASLRFDGALNVDLTRVPD*LGALPPYPLPHWSRTRQSSLPRRPT--HEQLSVAEI 578 +S +T LRF G LN DL ++ + P+P H+ + L R + + L+V E+ Sbjct: 129 MSGVTTCLRFPGQLNADLRKL---AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPEL 185 Query: 577 T 575 T Sbjct: 186 T 186 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 27.5 bits (58), Expect = 0.52 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = -2 Query: 751 VSSITASLRFDGALNVDLTRVPD*LGALPPYPLPHWSRTRQSSLPRRPT--HEQLSVAEI 578 +S +T LRF G LN DL ++ + P+P H+ + L R + + L+V E+ Sbjct: 129 MSGVTTCLRFPGQLNADLRKL---AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPEL 185 Query: 577 T 575 T Sbjct: 186 T 186 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 27.1 bits (57), Expect = 0.68 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +3 Query: 519 CHDGGSHFTIWLAGSKHAFVISATESCSWVGLLGRDDWRVR 641 C D S+ TIWL GS+ ++ SW G D VR Sbjct: 421 CRDFNSN-TIWLNGSRPGLELAGRPYVSWNGWKAIDSEEVR 460 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 26.6 bits (56), Expect = 0.90 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +3 Query: 642 DQWGSGYGGKA---PS*SGTRVRSTFRAPSNLK 731 D GSGYGG+A + TR +++ A SNLK Sbjct: 2116 DYSGSGYGGRAIGDGTVQATRFHASWHAHSNLK 2148 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 26.6 bits (56), Expect = 0.90 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +3 Query: 642 DQWGSGYGGKA---PS*SGTRVRSTFRAPSNLK 731 D GSGYGG+A + TR +++ A SNLK Sbjct: 2117 DYSGSGYGGRAIGDGTVQATRFHASWHAHSNLK 2149 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 290 LGLALTTSSTSCTPSVLSCTGTSVRVWRRESSPKPV 183 L + TTS+TS T + + T T+ ++P PV Sbjct: 138 LSMGATTSTTSTTATTTTTTTTTTTTTTTTTTPNPV 173 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 25.4 bits (53), Expect = 2.1 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 649 HWSRTRQSSLPRRPTHEQLSVAEITNACFEPANQMVKCDP 530 H + TR++ PRRP E + VA N + +K DP Sbjct: 241 HPASTREALPPRRPKTEAVLVAPGENITHVEILRKLKADP 280 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 165 RGQPGPHGLRRTLPPPYP 218 RG+PGP G L PP P Sbjct: 627 RGEPGPKGEPGLLGPPGP 644 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 23.8 bits (49), Expect = 6.4 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +1 Query: 463 VHILGYDVTTVQHTASHV 516 +H + Y ++TV HTAS++ Sbjct: 733 IHTIEYVLSTVSHTASYL 750 >AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 23.4 bits (48), Expect = 8.4 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = -1 Query: 731 FEIRRRSECGPHPSSRLTWCLTPVSTSPLVTYAPVISAEKAYP*TAFRRRDHKR 570 + I RRS G + + + V PLV Y I E AY RR +R Sbjct: 68 YRISRRSGDGNGNAGMVEKRTSMVDEGPLVPYPWAIDREVAYAFLRTRRTGKRR 121 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.4 bits (48), Expect = 8.4 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = -3 Query: 369 TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFV 235 T + D+AKV+ AV + + ++ A +++ +DL A A + Sbjct: 991 TALLENDIAKVKHAVVIQNGMNYLSNQLAFINNPYDLSIATYAMM 1035 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 856,723 Number of Sequences: 2352 Number of extensions: 20206 Number of successful extensions: 72 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -