BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_K13 (803 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 5.8 >SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -1 Query: 524 YLKVMGGQKIFRTNLAR-CYNRYKNEIQSNISRLKVEFT 411 +L++M G + R ++ R C NRY I + SRLK+ FT Sbjct: 1569 FLELMDGGQDSRMSIGRFCGNRYPLSIMTATSRLKIVFT 1607 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 216 KNGQCLMAIQSGRNIKVFSHDNDGYFN*FMVFSRP 112 KNGQ + + GR K+F + D Y F RP Sbjct: 1802 KNGQTFIRYREGRATKIFQGNYDRYITVTHTFKRP 1836 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,384,378 Number of Sequences: 59808 Number of extensions: 504463 Number of successful extensions: 1430 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1430 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2227723674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -