BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_K13 (803 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC027951-1|AAH27951.1| 672|Homo sapiens C20orf32 protein protein. 31 6.4 AL121914-13|CAC12719.2| 786|Homo sapiens chromosome 20 open rea... 31 6.4 AJ276678-1|CAC00655.1| 785|Homo sapiens HEF like Protein protein. 31 6.4 BC008352-1|AAH08352.1| 421|Homo sapiens KIAA1909 protein protein. 30 8.5 AB067496-1|BAB67802.2| 1287|Homo sapiens KIAA1909 protein protein. 30 8.5 >BC027951-1|AAH27951.1| 672|Homo sapiens C20orf32 protein protein. Length = 672 Score = 30.7 bits (66), Expect = 6.4 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -2 Query: 322 CNLTETKLVPQA*DQVRXLSSSYIVIYTTRTFGIIEKWPV 203 CNLT++ L + DQ++ +S+SY ++ T+ WP+ Sbjct: 505 CNLTDSNLQNRIRDQMQTISNSYRILLETKESLDNRNWPL 544 >AL121914-13|CAC12719.2| 786|Homo sapiens chromosome 20 open reading frame 32 protein. Length = 786 Score = 30.7 bits (66), Expect = 6.4 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -2 Query: 322 CNLTETKLVPQA*DQVRXLSSSYIVIYTTRTFGIIEKWPV 203 CNLT++ L + DQ++ +S+SY ++ T+ WP+ Sbjct: 505 CNLTDSNLQNRIRDQMQTISNSYRILLETKESLDNRNWPL 544 >AJ276678-1|CAC00655.1| 785|Homo sapiens HEF like Protein protein. Length = 785 Score = 30.7 bits (66), Expect = 6.4 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -2 Query: 322 CNLTETKLVPQA*DQVRXLSSSYIVIYTTRTFGIIEKWPV 203 CNLT++ L + DQ++ +S+SY ++ T+ WP+ Sbjct: 504 CNLTDSNLQNRIRDQMQTISNSYRILLETKESLDNRNWPL 543 >BC008352-1|AAH08352.1| 421|Homo sapiens KIAA1909 protein protein. Length = 421 Score = 30.3 bits (65), Expect = 8.5 Identities = 17/50 (34%), Positives = 21/50 (42%) Frame = -2 Query: 676 SFPFSXSSWIRFRYRTKTIPRTFRYASVSKLNTLCLCNYAPFPRWLCEQA 527 SFP+S WI FR R + A + N+ C N PR E A Sbjct: 248 SFPYSHGDWICFRQRLEHFAANCEEAIIFLQNSFCSLNTHRTPRTAQEVA 297 >AB067496-1|BAB67802.2| 1287|Homo sapiens KIAA1909 protein protein. Length = 1287 Score = 30.3 bits (65), Expect = 8.5 Identities = 17/50 (34%), Positives = 21/50 (42%) Frame = -2 Query: 676 SFPFSXSSWIRFRYRTKTIPRTFRYASVSKLNTLCLCNYAPFPRWLCEQA 527 SFP+S WI FR R + A + N+ C N PR E A Sbjct: 350 SFPYSHGDWICFRQRLEHFAANCEEAIIFLQNSFCSLNTHRTPRTAQEVA 399 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,059,849 Number of Sequences: 237096 Number of extensions: 2363945 Number of successful extensions: 7974 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7974 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9924838204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -