BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_K12 (800 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) 59 5e-09 SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) 59 5e-09 SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) 59 5e-09 SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34) 55 6e-08 SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28) 55 6e-08 SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) 38 0.012 SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) 33 0.20 SB_57880| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0) 29 5.8 SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) 29 5.8 SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) 29 5.8 SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) 29 5.8 SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) 29 5.8 SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) 29 5.8 SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0) 29 5.8 SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) 29 5.8 SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) 29 5.8 SB_2016| Best HMM Match : HEAT (HMM E-Value=8.6e-07) 28 7.7 >SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 58.8 bits (136), Expect = 5e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQY 603 GEGMDEMEFTEAESNMNDLVSEYQQY Sbjct: 400 GEGMDEMEFTEAESNMNDLVSEYQQY 425 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -3 Query: 777 GNSTRHSRSCSSAFSEQFTAMFRRKAFLHXYT 682 GNST + SEQFTAMFRRKAFLH YT Sbjct: 369 GNSTA-IQELFKRISEQFTAMFRRKAFLHWYT 399 >SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) Length = 391 Score = 58.8 bits (136), Expect = 5e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQY 603 GEGMDEMEFTEAESNMNDLVSEYQQY Sbjct: 345 GEGMDEMEFTEAESNMNDLVSEYQQY 370 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -3 Query: 777 GNSTRHSRSCSSAFSEQFTAMFRRKAFLHXYT 682 GNST + SEQFTAMFRRKAFLH YT Sbjct: 314 GNSTA-IQELFKRISEQFTAMFRRKAFLHWYT 344 >SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 58.8 bits (136), Expect = 5e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQY 603 GEGMDEMEFTEAESNMNDLVSEYQQY Sbjct: 400 GEGMDEMEFTEAESNMNDLVSEYQQY 425 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -3 Query: 777 GNSTRHSRSCSSAFSEQFTAMFRRKAFLHXYT 682 GNST + SEQFTAMFRRKAFLH YT Sbjct: 369 GNSTA-IQELFKRISEQFTAMFRRKAFLHWYT 399 >SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34) Length = 747 Score = 55.2 bits (127), Expect = 6e-08 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQY 603 GEGMDEMEFTEAESNM+DL++EYQQY Sbjct: 165 GEGMDEMEFTEAESNMHDLIAEYQQY 190 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 732 EQFTAMFRRKAFLHXYT 682 EQFTAMFRRKAFLH YT Sbjct: 148 EQFTAMFRRKAFLHWYT 164 >SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28) Length = 271 Score = 55.2 bits (127), Expect = 6e-08 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQY 603 GEGMDEMEFTEAESNM+DL++EYQQY Sbjct: 227 GEGMDEMEFTEAESNMHDLIAEYQQY 252 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 732 EQFTAMFRRKAFLHXYT 682 EQFTAMFRRKAFLH YT Sbjct: 210 EQFTAMFRRKAFLHWYT 226 >SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) Length = 629 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -3 Query: 738 FSEQFTAMFRRKAFLHXYT 682 F+EQF AMFRR+AFLH YT Sbjct: 200 FTEQFAAMFRRRAFLHWYT 218 Score = 32.7 bits (71), Expect(2) = 0.012 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 Query: 656 FTEAESNMNDLVSEYQQY 603 + A+SN+NDL+SEYQQY Sbjct: 256 YFSADSNLNDLISEYQQY 273 Score = 23.8 bits (49), Expect(2) = 0.012 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 677 EGMDEMEFTEAESN 636 EGMD +EFTE + N Sbjct: 220 EGMDPLEFTEIKRN 233 >SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 375 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = -1 Query: 677 EGMDEMEFTEAESNMNDLVSEYQQ 606 EGMD +F EA++++ DL+S YQQ Sbjct: 306 EGMDSQQFEEADNDILDLISTYQQ 329 >SB_57880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 24 GEGMEEGEFSEAREDLAALEKDYEE 48 >SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 232 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 208 GEGMEEGEFSEAREDLAALEKDYEE 232 >SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) Length = 536 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 394 GEGMEEGEFSEAREDLAALEKDYEE 418 >SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) Length = 149 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 108 GEGMEEGEFSEAREDLAALEKDYEE 132 >SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 562 GEGMEEGEFSEAREDLAALEKDYEE 586 >SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 347 GEGMEEGEFSEAREDLAALEKDYEE 371 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 781 GEGMEEGEFSEAREDLAALEKDYEE 805 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 1190 GEGMEEGEFSEAREDLAALEKDYEE 1214 >SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 410 GEGMEEGEFSEAREDLAALEKDYEE 434 >SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 395 GEGMEEGEFSEAREDLAALEKDYEE 419 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 826 GEGMEEGEFSEAREDLAALEKDYEE 850 >SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 375 GEGMEEGEFSEAREDLAALEKDYEE 399 >SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) Length = 885 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 410 GEGMEEGEFSEAREDLAALEKDYEE 434 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 843 GEGMEEGEFSEAREDLAALEKDYEE 867 >SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) Length = 1036 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 995 GEGMEEGEFSEAREDLAALEKDYEE 1019 >SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 377 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 335 GEGMEEGEFSEAREDLAALEKDYEE 359 >SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 250 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 208 GEGMEEGEFSEAREDLAALEKDYEE 232 >SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) Length = 365 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 323 GEGMEEGEFSEAREDLAALEKDYEE 347 >SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) Length = 451 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 680 GEGMDEMEFTEAESNMNDLVSEYQQ 606 GEGM+E EF+EA ++ L +Y++ Sbjct: 410 GEGMEEGEFSEAREDLAALEKDYEE 434 >SB_2016| Best HMM Match : HEAT (HMM E-Value=8.6e-07) Length = 502 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +3 Query: 183 NQVQPYKKKDLFPLCDSVTAPRACSAEGLASLRVAVYCNKHSRAALR 323 +++Q L LC SV+ C+ A L ++C + S A LR Sbjct: 136 SRLQQLASLSLTDLCQSVSGDEGCAVAETAELIALMHCLESSAATLR 182 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,985,673 Number of Sequences: 59808 Number of extensions: 372697 Number of successful extensions: 948 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 948 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -