BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_K09 (798 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5KC86 Cluster: Putative uncharacterized protein; n=1; ... 33 6.3 UniRef50_Q72JY9 Cluster: HD-hydrolase domain; n=2; Thermus therm... 33 8.3 >UniRef50_A5KC86 Cluster: Putative uncharacterized protein; n=1; Plasmodium vivax|Rep: Putative uncharacterized protein - Plasmodium vivax Length = 809 Score = 33.5 bits (73), Expect = 6.3 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = +1 Query: 427 RHIASNLKDIISEGINDAIRRDDILHSTMLLYKQSPPRCLLPTAWRGVAWRGVAWRGVAG 606 R I+S + + + I +DD ++ L S LL W+G W+G W+G++ Sbjct: 200 RAISSKDPSVCKPSLTEMILKDDDIYRDNTLPHSSH---LLSEGWKGEDWKGAGWKGLST 256 Query: 607 RHG 615 G Sbjct: 257 GRG 259 >UniRef50_Q72JY9 Cluster: HD-hydrolase domain; n=2; Thermus thermophilus|Rep: HD-hydrolase domain - Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) Length = 907 Score = 33.1 bits (72), Expect = 8.3 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +1 Query: 385 RYGSANSLLQAATARHIASNLKDIISEGINDAIRRDDILHSTMLLYKQSPPRCLLPTAWR 564 R + + Q A A + NLK+++ ++ A+R + +LLY++ PPR L A R Sbjct: 385 RERTLEAFAQVALALRQSENLKEMMESALDAALRITEAGAGALLLYEEDPPR-LTEEAAR 443 Query: 565 G 567 G Sbjct: 444 G 444 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 635,832,172 Number of Sequences: 1657284 Number of extensions: 11006056 Number of successful extensions: 27005 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26963 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 68319938570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -