BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_K09 (798 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 27 0.23 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 25 0.70 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 24 1.2 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 8.6 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 8.6 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 26.6 bits (56), Expect = 0.23 Identities = 17/59 (28%), Positives = 23/59 (38%), Gaps = 2/59 (3%) Frame = +2 Query: 380 CYDTDPRTVCCRRLQHAT*RRI*RILFLKVLMTQSGVTISYTVLCYCTNS--RRRGASC 550 C + + C R AT ++ R+ L SG T + V C C S RR C Sbjct: 876 CKCENGKPTCWRECDKATCEKLFRMKKSSALRPASGGTTARVVRCVCAGSTGTRRATGC 934 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 25.0 bits (52), Expect = 0.70 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +1 Query: 25 SYYLLDQVKEECDMSRRFLVTQYNAVVLRRGDDAAGSIKSKPL 153 SYY LD + E+ R ++ + R DD A SK L Sbjct: 116 SYYSLDDLSEDTFYDIRLWGVSFSKKQILRSDDLAVKTTSKSL 158 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 442 NLKDIISEGINDAIRRDDILHSTM 513 N KD+ + +ND R+DD+L + M Sbjct: 192 NGKDLDDDDMNDDDRKDDLLGNNM 215 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 381 VTIRIREQFAAGGYSTPHSVEFKG 452 V + + E + GY TP S+ ++G Sbjct: 32 VRLLVTEGWDEEGYHTPESLHYEG 55 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +1 Query: 232 DGRAPPGAATEAPPLNTARLH 294 +G PG E PP N +H Sbjct: 92 NGEWVPGGKAEVPPSNPIYIH 112 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,456 Number of Sequences: 336 Number of extensions: 2939 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -