BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_K09 (798 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0483 + 3633010-3633203,3633652-3633957,3634598-3634821,363... 29 4.3 03_01_0225 + 1784211-1784324,1784398-1784668,1784992-1785248,178... 29 4.3 03_06_0092 + 31589665-31589807,31590111-31590243,31590316-31590546 28 7.5 01_06_0818 - 32220143-32220160,32220556-32220663,32220749-322209... 28 9.9 >07_01_0483 + 3633010-3633203,3633652-3633957,3634598-3634821, 3635722-3635825,3636528-3636662,3637537-3637705, 3638074-3638209,3639200-3639338,3640487-3640663, 3640874-3641041,3641363-3641458,3642217-3642345, 3642439-3642669 Length = 735 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +1 Query: 379 LLRYGSANSLLQAATARHIASNLKDIISEGINDAI 483 L YG + L+ TA H LKDI+S G D I Sbjct: 47 LTGYGCEDHFLEQDTAAHAWECLKDILSGGYTDGI 81 >03_01_0225 + 1784211-1784324,1784398-1784668,1784992-1785248, 1785338-1785450,1791599-1791746,1791943-1792080, 1792448-1792525 Length = 372 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 189 FTIQIHKHLMLAGTRWPGASWCGH 260 F I + KHL G + GA WC H Sbjct: 272 FAIALAKHLHSVGAKMYGAFWCSH 295 >03_06_0092 + 31589665-31589807,31590111-31590243,31590316-31590546 Length = 168 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 211 CL*ICIVNLKNLSDCTLPMLRVYSLLI-LPRRPPG 110 C + I+ L CTL M+ VYS+L+ P R PG Sbjct: 48 CFLVTIMGLVIPWSCTLAMIDVYSILVGCPLRVPG 82 >01_06_0818 - 32220143-32220160,32220556-32220663,32220749-32220992, 32221599-32221834,32222058-32222248,32222330-32222567, 32222672-32222890 Length = 417 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +1 Query: 415 AATARHIASNLKDIISEGINDAIRRDDILHSTMLLYKQSPPRCLLPTAWRGVA-WRGVA 588 +A +I + + I++E +++I+ ++LH L +P CLL G A W+ +A Sbjct: 170 SAELLNIWNEREKILAETNHESIKICEVLHQRPLANLPTPENCLLGKIQEGTADWQKIA 228 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,397,422 Number of Sequences: 37544 Number of extensions: 310930 Number of successful extensions: 914 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 913 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -