BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_K06 (790 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 25 0.69 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 22 4.9 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 6.4 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 25.0 bits (52), Expect = 0.69 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 Query: 300 EMKADGLLEYFRPLHDWLRAENQRTGEHIGWEPTN 196 E KADG + RP+ W RA G++ ++P N Sbjct: 719 ECKADG---FPRPVVTWKRATGVSPGDYKDFKPNN 750 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 542 YHVSANVEYARYYVSFIIQFQFHRAL 465 Y+ VE+ ++Y FI+ F + L Sbjct: 140 YYEQYAVEFFQFYAQFIVYFLIYAVL 165 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 Query: 704 YRSHTPWTCSDTVCS 660 YR WT SD C+ Sbjct: 680 YRQEAQWTSSDNPCT 694 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,078 Number of Sequences: 336 Number of extensions: 2569 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -