BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_K03 (800 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 26 1.6 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 25 2.1 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 25 2.7 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 25 3.6 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 24 4.8 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 24 4.8 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 24 4.8 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 8.3 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.8 bits (54), Expect = 1.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 586 QYQNLTKSSRKSLTPSKRKCLMKSKCLLTSPT 491 Q NL++ + + T + CL + + LLT+PT Sbjct: 7 QEVNLSRRACRPTTTNNDDCLQEQRTLLTTPT 38 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 25.4 bits (53), Expect = 2.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 642 NGDLNFVGHWLVYGHWVGLFNMDGV 716 +GDLN V L+ G W G + D + Sbjct: 436 DGDLNLVKRVLMLGSWPGAMHADDI 460 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 25.0 bits (52), Expect = 2.7 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -2 Query: 508 LLTSPTRSTKEVQVPLVKEVPYPVKYHVPI 419 L +S + +K V VP+ ++V PV + VPI Sbjct: 155 LHSSVSEKSKTVPVPVFQKVGVPVPHPVPI 184 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 24.6 bits (51), Expect = 3.6 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -3 Query: 687 SDRTQASALRS*GPR*QALQGRSREALSGPR*SASTKTLRSHQENPLHRR 538 S R+++ +L R ++ RSR S R + T+T RS PL R Sbjct: 416 SSRSRSRSLSRSVSRSRSRGSRSRSRTSQSRSRSKTRTSRSRSRTPLPAR 465 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/54 (22%), Positives = 23/54 (42%) Frame = +3 Query: 81 IRINNKHVKANKVITDYNYTTSRLGNELPRSVYQRKRRLK*CSQQPINTQNTTT 242 I N H K++ T N++ + P S+ R+R + + ++ T T Sbjct: 507 ITTTNTHPKSSASSTSLNHSNPISSSAPPSSIVSRRRFFNTSASSSVTSEGTIT 560 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/54 (22%), Positives = 23/54 (42%) Frame = +3 Query: 81 IRINNKHVKANKVITDYNYTTSRLGNELPRSVYQRKRRLK*CSQQPINTQNTTT 242 I N H K++ T N++ + P S+ R+R + + ++ T T Sbjct: 508 ITTTNTHPKSSASSTSLNHSNPISSSAPPSSIVSRRRFFNTSASSSVTSEGTIT 561 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 24.2 bits (50), Expect = 4.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 559 RKSLTPSKRKCLMKSKC 509 ++++TP R +MKSKC Sbjct: 58 KENMTPEDRSLVMKSKC 74 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.4 bits (48), Expect = 8.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +3 Query: 570 VRFWYWHFNGDRIGLLYFD 626 ++F W FNGD++ L ++ Sbjct: 167 MKFGSWTFNGDQVSLALYN 185 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 642,988 Number of Sequences: 2352 Number of extensions: 12141 Number of successful extensions: 29 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84408009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -