BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_K01 (807 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 24 1.2 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 22 5.0 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 22 5.0 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 22 6.6 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.7 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/59 (25%), Positives = 22/59 (37%) Frame = +3 Query: 369 PTXNGHAPPPTESRKSC*SVNPSGVRAW*DFPC*VKLSRRLHSWWCPSVNSFKFQLCNH 545 P N H T K C V + + W ++ +RL CP + +K L H Sbjct: 191 PKVNSHGKIKTFKCKQCDFVAITKLEQWNHSKVHIREDKRLTCPKCPFITEYKHHLEYH 249 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 22.2 bits (45), Expect = 5.0 Identities = 15/59 (25%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +2 Query: 407 KKELLICQSFRCPGLVRFPVLSQIKPQAPLLVVPF-RQFL*VSAL-QPYSPRXSKIFGF 577 K L + ++ G+++FP+ + + L +PF F +S + YS + S IF + Sbjct: 50 KTPLPLTLLYKLLGIIQFPISAHFSFMSRFLCLPFYSYFFYLSYIYTTYSRKLSGIFKY 108 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 22.2 bits (45), Expect = 5.0 Identities = 15/59 (25%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +2 Query: 407 KKELLICQSFRCPGLVRFPVLSQIKPQAPLLVVPF-RQFL*VSAL-QPYSPRXSKIFGF 577 K L + ++ G+++FP+ + + L +PF F +S + YS + S IF + Sbjct: 6 KTPLPLTLLYKLLGIIQFPISAHFSFMSRFLCLPFYSYFFYLSYIYTTYSRKLSGIFKY 64 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 21.8 bits (44), Expect = 6.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 352 PDKSLHQLXTAMHHHPPNQERAVNLSIL 435 P +S H+L T + +PPN AV S L Sbjct: 44 PLESNHKLVTFILKNPPNLNPAVQGSSL 71 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 540 NHTPPGSPKSLVSRKL 587 N+ PPG P S VS L Sbjct: 533 NNQPPGGPSSHVSAVL 548 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,833 Number of Sequences: 336 Number of extensions: 2998 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -