BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J22 (782 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 31 0.053 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 26 1.5 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 24 4.6 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 30.7 bits (66), Expect = 0.053 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = -2 Query: 457 GRHSEAFQCLNKALSIDPRNVEGLVARGALYANSGTFKK 341 G A QC K L P N E + G+LYA S + K Sbjct: 354 GDSENAAQCFEKVLKAQPGNYETMKILGSLYATSSSQSK 392 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 25.8 bits (54), Expect = 1.5 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = -3 Query: 660 WRRAQASIIPTAFNSSLNILALPTCTAQISHI*EEDSL---HRNTQMNYAKHKQV 505 WR+ ++PT F + +L L A I H+ ++ ++ H T+M H ++ Sbjct: 984 WRKRGIHVVPTMFGIAFTVLHLNQSGALI-HVYQDGTVLLTHGGTEMGQGLHTKM 1037 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 24.2 bits (50), Expect = 4.6 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -3 Query: 255 LGRSYEDENQITEAQKAYEDCLAIIPFHEEAQNSLDFLKSKT 130 +GR DEN +KAY D L+ +++ + F K T Sbjct: 478 VGRGLTDENMQYMYRKAYRDKLSFSVSNDQMISFAQFCKDTT 519 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 753,433 Number of Sequences: 2352 Number of extensions: 14466 Number of successful extensions: 26 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -