BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J10 (785 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0514 - 4270936-4272084 29 5.5 02_01_0583 + 4320543-4321613,4321725-4321967,4323506-4323883 28 9.7 >05_01_0514 - 4270936-4272084 Length = 382 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 237 YTIIVHL*CSIILYRTRNKLLFSF 166 Y +IVHL C++I Y TR+ L ++ Sbjct: 323 YVVIVHLDCNLIYYITRDYTLMAY 346 >02_01_0583 + 4320543-4321613,4321725-4321967,4323506-4323883 Length = 563 Score = 27.9 bits (59), Expect = 9.7 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -1 Query: 275 HLRNIGINRFVYFTP**FIC--NVRSFCIEQETNCYFPLFITKSVV 144 HL + G+ V P C NV + CIE E+N FP + S++ Sbjct: 377 HL-HFGVRNEVKMLPSFLRCFPNVETLCIEVESNPPFPALVVSSII 421 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,058,617 Number of Sequences: 37544 Number of extensions: 308022 Number of successful extensions: 515 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 515 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2115411120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -