BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J10 (785 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_49599| Best HMM Match : DDE (HMM E-Value=3.7e-20) 28 9.9 >SB_17956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1449 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 405 YMVMARWPYHTYQRCQNSS 349 +MV A WPY T C N+S Sbjct: 563 WMVQAEWPYATENSCDNTS 581 >SB_49599| Best HMM Match : DDE (HMM E-Value=3.7e-20) Length = 428 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 564 KYKRQHNSVKTHTNRKKVGILDSRIGDWKLKTRSV 668 K+KRQHN + + ++ G+ + WK + R + Sbjct: 124 KFKRQHNIGQRAVSGEEAGVNPETVESWKERAREI 158 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,218,446 Number of Sequences: 59808 Number of extensions: 406903 Number of successful extensions: 760 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 759 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -