BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J08 (803 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1E7.09 |ogm2|oma2|protein O-mannosyltransferase Ogm2|Schizo... 33 0.047 SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe... 29 0.77 SPBC947.04 |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Manual 27 4.1 >SPAPB1E7.09 |ogm2|oma2|protein O-mannosyltransferase Ogm2|Schizosaccharomyces pombe|chr 1|||Manual Length = 739 Score = 33.1 bits (72), Expect = 0.047 Identities = 14/59 (23%), Positives = 28/59 (47%) Frame = -2 Query: 652 VTLDFPASQRSTYRAQRWAWAHELWRPRSVSCYIGTESTLLPKWNRRKLVSFLRSEPGP 476 V + + + R Y + + +L+ P V CY+ + S+ LP W ++ + +P P Sbjct: 452 VNILYDTAHRDAYNVRSLSTVFQLYNP-VVGCYLSSSSSSLPSWGFGQIEMYCDPDPDP 509 >SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 29.1 bits (62), Expect = 0.77 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 32 GGRAHSPPTVKWLLEPIDIY 91 GG H P TV WLL P DIY Sbjct: 235 GGPLHDPNTVMWLLRP-DIY 253 >SPBC947.04 |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Manual Length = 973 Score = 26.6 bits (56), Expect = 4.1 Identities = 22/66 (33%), Positives = 28/66 (42%) Frame = -1 Query: 392 DVRIPQAGTKFSNEICT*QLFTIGFHVEGITSCNNNQTRKLINGVITGGGTSCESARVGT 213 +V IP AGT EI +L+T F G TS +I T T ++ T Sbjct: 366 EVVIPTAGTVTETEISGSELYTSTFPANGTTS---GTVEVVIPTAGTRTVTKISGSKFFT 422 Query: 212 TTTPIS 195 TTT S Sbjct: 423 TTTDAS 428 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,356,130 Number of Sequences: 5004 Number of extensions: 70903 Number of successful extensions: 131 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 390427050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -