BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J08 (803 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC130578-1|AAI30579.1| 1935|Homo sapiens ADAM metallopeptidase w... 33 1.6 AF488803-1|AAO15765.1| 1935|Homo sapiens a disintegrin-like and ... 33 1.6 AB037733-1|BAA92550.1| 1471|Homo sapiens KIAA1312 protein protein. 33 1.6 >BC130578-1|AAI30579.1| 1935|Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 9 protein. Length = 1935 Score = 32.7 bits (71), Expect = 1.6 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 637 PASQRSTYRAQRWAWAHELWRPRSVSCYIGT 545 P ++RSTY A R W W P S +C GT Sbjct: 1172 PETRRSTYSAPRTQWRFGSWTPCSATCGKGT 1202 >AF488803-1|AAO15765.1| 1935|Homo sapiens a disintegrin-like and metalloprotease with thrombospondin type 1 motifs 9B protein. Length = 1935 Score = 32.7 bits (71), Expect = 1.6 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 637 PASQRSTYRAQRWAWAHELWRPRSVSCYIGT 545 P ++RSTY A R W W P S +C GT Sbjct: 1172 PETRRSTYSAPRTQWRFGSWTPCSATCGKGT 1202 >AB037733-1|BAA92550.1| 1471|Homo sapiens KIAA1312 protein protein. Length = 1471 Score = 32.7 bits (71), Expect = 1.6 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 637 PASQRSTYRAQRWAWAHELWRPRSVSCYIGT 545 P ++RSTY A R W W P S +C GT Sbjct: 1014 PETRRSTYSAPRTQWRFGSWTPCSATCGKGT 1044 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,944,740 Number of Sequences: 237096 Number of extensions: 2811447 Number of successful extensions: 5526 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5524 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9924838204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -