BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J08 (803 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051447-1|AAK92871.1| 1001|Drosophila melanogaster GH11567p pro... 31 2.4 AE014296-1723|AAF50214.1| 1001|Drosophila melanogaster CG18176-P... 31 2.4 >AY051447-1|AAK92871.1| 1001|Drosophila melanogaster GH11567p protein. Length = 1001 Score = 30.7 bits (66), Expect = 2.4 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 181 YCFTAEIGVVVVPTRADSQEVPPPVITPFISLRV*LLLH 297 Y F+ ++V D+ E+PPP I P ++ R+ L+LH Sbjct: 466 YAFSTAEDLIVDENAMDTDELPPPEINPMLA-RLPLILH 503 >AE014296-1723|AAF50214.1| 1001|Drosophila melanogaster CG18176-PA protein. Length = 1001 Score = 30.7 bits (66), Expect = 2.4 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 181 YCFTAEIGVVVVPTRADSQEVPPPVITPFISLRV*LLLH 297 Y F+ ++V D+ E+PPP I P ++ R+ L+LH Sbjct: 466 YAFSTAEDLIVDENAMDTDELPPPKINPMLA-RLPLILH 503 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,339,374 Number of Sequences: 53049 Number of extensions: 889283 Number of successful extensions: 2455 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2455 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3757402116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -