BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J08 (803 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 25 0.82 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 0.82 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.9 M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-... 23 4.4 AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. 22 7.7 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 25.0 bits (52), Expect = 0.82 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -2 Query: 646 LDFPASQRSTYRAQRWAWAHELWRP 572 L P + YR W H +WRP Sbjct: 66 LRLPENMSEDYRILDVDWLHNIWRP 90 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.0 bits (52), Expect = 0.82 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = -3 Query: 666 LAPTK*PSTFQLHSGVRIALNAGRGLTSSGGRALSPATSARSRHCCRSGTEGNW 505 LA K + L S + N+G G T+S R SPA + S T W Sbjct: 521 LAVAKQQNQVPLTSSSNVNNNSGNGNTNSSARDSSPAIESISVDSGSINTVAEW 574 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 296 CNNNQTRKLINGVITGGGTSCESARV 219 CN RK+I+GV+ G +S S +V Sbjct: 203 CNKTAVRKVISGVV-GAASSVTSIQV 227 >M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H15. ). Length = 74 Score = 22.6 bits (46), Expect = 4.4 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 73 GAHRHLPRKCATHLEI*VLRSQYSYNGYLTLR 168 G R R+ T + L ++ YN YLT R Sbjct: 5 GCPRRRGRQTYTRFQTLELEKEFHYNHYLTRR 36 >AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. Length = 122 Score = 21.8 bits (44), Expect = 7.7 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 53 PTVKWLLEPIDIYH 94 P + WL + I++YH Sbjct: 52 PEITWLKDGIELYH 65 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 239,207 Number of Sequences: 438 Number of extensions: 5812 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25489170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -