BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J08 (803 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43040.1 68418.m05254 DC1 domain-containing protein contains ... 28 8.3 At3g14000.2 68416.m01768 expressed protein 28 8.3 At3g14000.1 68416.m01767 expressed protein 28 8.3 >At5g43040.1 68418.m05254 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 551 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -2 Query: 778 NRRXKKFILIPXLXKAXTNCSYCRVYVLRNHXSGSCXTXTHKV 650 NR + +P L +C CR V H + SC T T V Sbjct: 174 NRHDHRISHVPRLGSGNWSCGVCRKEVNGMHGAFSCLTCTFAV 216 >At3g14000.2 68416.m01768 expressed protein Length = 374 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -3 Query: 600 GRGLTSSGGRALSPATSARSRHCCRSG 520 G+G SSG A P T +SRH SG Sbjct: 241 GKGYASSGSLAHQPTTQTQSRHHDSSG 267 >At3g14000.1 68416.m01767 expressed protein Length = 374 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -3 Query: 600 GRGLTSSGGRALSPATSARSRHCCRSG 520 G+G SSG A P T +SRH SG Sbjct: 241 GKGYASSGSLAHQPTTQTQSRHHDSSG 267 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,023,374 Number of Sequences: 28952 Number of extensions: 400631 Number of successful extensions: 862 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1824072800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -