BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J06 (842 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 48 1e-07 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 24 2.0 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 8.1 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 48.0 bits (109), Expect = 1e-07 Identities = 44/150 (29%), Positives = 62/150 (41%), Gaps = 1/150 (0%) Frame = -3 Query: 558 DIALLFLETPLDSAPNVGVACLPPAR-ERAPAGVRCFATGWGKDKFGKEGRYQVIMKKVD 382 DIALL E + VG ACLP + AG GWG F G I++K Sbjct: 257 DIALLKTEKDIKFGDKVGPACLPFQHFLDSFAGSDVTVLGWGHTSF--NGMLSHILQKTT 314 Query: 381 VPVVDRNTCQSQLRRTRLGRFFQLHSTFMCAGGEPDKDTCRGDGGSPLVCPIDYEKNRYV 202 + ++ + C + + MCA + KD C+ D G P++ K R V Sbjct: 315 LNMLTQVECYKY--------YGNIMVNAMCAYAK-GKDACQMDSGGPVLWQNPRTK-RLV 364 Query: 201 QYGIVAWGIGCGEDGTPGVYVDVSNLRTWI 112 GI++WG CG+ P V + WI Sbjct: 365 NIGIISWGAECGK--YPNGNTKVGSYIDWI 392 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 239 RGDPPSPRQVSLSGSPP 289 RG PP+P Q G PP Sbjct: 36 RGSPPNPSQGPPPGGPP 52 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 8.1 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -1 Query: 92 RDTILDPTSPRSNKIV*YEI 33 + +ILDP+S N++ YE+ Sbjct: 242 KGSILDPSSDSQNEVGFYEV 261 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,614 Number of Sequences: 438 Number of extensions: 3426 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27067071 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -