BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J06 (842 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06740.1 68418.m00762 lectin protein kinase family protein co... 30 2.2 At3g03940.1 68416.m00412 protein kinase family protein contains ... 29 3.9 At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helica... 28 6.8 At3g21290.1 68416.m02690 dentin sialophosphoprotein-related cont... 28 6.8 At3g21140.1 68416.m02671 expressed protein 28 6.8 At3g54250.1 68416.m05996 mevalonate diphosphate decarboxylase, p... 28 8.9 At3g49290.1 68416.m05387 expressed protein 28 8.9 >At5g06740.1 68418.m00762 lectin protein kinase family protein contains Legume lectins beta-chain signature, PROSITE:PS00307 and Serine/Threonine protein kinases active-site signature, PROSITE:PS00108 Length = 652 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = +2 Query: 272 LSGSPPAHMNVECNWKNRPSRVLLNWLWQVFR 367 +SG P+++ V+ N +N + ++NWLW+++R Sbjct: 527 VSGKKPSYVLVKDN-QNNYNNSIVNWLWELYR 557 >At3g03940.1 68416.m00412 protein kinase family protein contains Pfam domains, PF00069: Protein kinase domain Length = 701 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 349 PVEEDAAGAVLPVALDVHVRGGGARQGHLPGGRGVAPRVP 230 P+ E A VLP RGGG +G+ +G AP P Sbjct: 21 PLVEQAENIVLPPQTATRRRGGGRGRGNAALAKGAAPPRP 60 >At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helicase, putative (RH30) strong similarity to ethylene-responsive RNA helicase [Lycopersicon esculentum] GI:5669638; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 591 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -2 Query: 331 AGAVLPVALDVHVRGGGARQGHLPGGRGVAPR 236 AG V+P L VR G+ G GGR PR Sbjct: 532 AGQVVPPTLSALVRSSGSGYGGSGGGRNFRPR 563 >At3g21290.1 68416.m02690 dentin sialophosphoprotein-related contains weak similarity to Dentin sialophosphoprotein precursor (Swiss-Prot:Q9NZW4) [Homo sapiens] Length = 1192 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +2 Query: 413 PSFPNLSFPQPVAKHLTPAGARSLAGGRHATPTFGAESNGVSRNSRA 553 PS SFP P +H +P G S GG + SN S + A Sbjct: 21 PSRNRNSFPPPTNRHPSPIGRMSSGGGGGGSAAPRQRSNSTSVKAAA 67 >At3g21140.1 68416.m02671 expressed protein Length = 387 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +2 Query: 404 WYLPSFPNLSFPQPVAKHLTPAGARSLAGGRHATPTFGAESNG 532 W+ S P FP+ + + G R A R+ TP+ G ++NG Sbjct: 32 WFCNSLPKTQFPKLRLSNGSSHGLRIQALLRNETPSEGEDNNG 74 >At3g54250.1 68416.m05996 mevalonate diphosphate decarboxylase, putative similar to mevalonate diphosphate decarboxylase [Arabidopsis thaliana] gi|2288887|emb|CAA74700 Length = 419 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 195 GIVAWGIGCGEDGTPGVYVDVSNLRTWID 109 G V W +G EDG+ V V +++ + W D Sbjct: 171 GFVKWTMGSKEDGSDSVAVQLADEKHWDD 199 >At3g49290.1 68416.m05387 expressed protein Length = 312 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +2 Query: 437 PQPVAKHLTPAGARSLAGGRHATPTFGAESNGVSRNSRAMS*NRFPLLKS 586 P PV K + + + R AT +F + ++ R++S +RFPLL+S Sbjct: 179 PPPVRKSTSQSSSPRQPPQRSATFSFTSTIPKKEQDKRSVSPHRFPLLRS 228 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,611,654 Number of Sequences: 28952 Number of extensions: 273714 Number of successful extensions: 626 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 626 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1950880000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -