BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J05 (814 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 26 1.2 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 26 1.2 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 25 3.7 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 24 6.4 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 6.4 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 8.5 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 26.2 bits (55), Expect = 1.2 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = +1 Query: 169 PTSDPLRGQNPDEV----GGLPRSTLQPDGAAHPKDAQPTEPSRRIEGSETSAVSV 324 P P R + P+ + G PRST P A P A P R + +++ SV Sbjct: 462 PPPVPERSKTPNSIYLSQNGTPRSTPVPFALAPPPAASPAFGDRSVRAVSSASNSV 517 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 26.2 bits (55), Expect = 1.2 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -3 Query: 404 RPGRLVLVQ---RGIPGHQRHRLGGPTGCRTETADVSEPSIRLEGSVGW 267 +PG +L++ RG PGH+ +GG T + D+ S++ G G+ Sbjct: 1244 KPGLNLLIRAGPRGQPGHRAVNIGGKTAVQVGPGDIF--SMKTPGGGGY 1290 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 24.6 bits (51), Expect = 3.7 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +3 Query: 189 RSEPG*GRGATAVNTTT-RRRGSPQGRPADGAFEANRRL 302 R + G GR + + T R+ GS G ADG+F AN+ L Sbjct: 15 REDYGYGRSSQQMLLLTGRQNGSTLG-DADGSFNANKAL 52 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.8 bits (49), Expect = 6.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 405 PTRQAGSGPAGYSGTPAAPSGRPDG 331 P RQ+G+ A S TP +G +G Sbjct: 199 PVRQSGNNNAANSSTPLTVNGTVNG 223 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.8 bits (49), Expect = 6.4 Identities = 19/63 (30%), Positives = 24/63 (38%) Frame = +3 Query: 219 TAVNTTTRRRGSPQGRPADGAFEANRRL*NVGRLGTAARRAAQTVPLVSRNTPLDQNQPA 398 TA + RRGS + E N R ARRA + S NTP + + Sbjct: 1087 TASHRRNNRRGSMLELSGEAIPEENYTKSLPERDKYGARRAPALIKASSTNTPKSAGRRS 1146 Query: 399 GSG 407 G G Sbjct: 1147 GGG 1149 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 8.5 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +1 Query: 193 QNPDEVGGLPRSTLQPDGAAHPKDAQPTEPSRRI 294 QNP V + +AHP+ + P RRI Sbjct: 1087 QNPSLVFSASSEATEGRESAHPERREQVRPQRRI 1120 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 707,615 Number of Sequences: 2352 Number of extensions: 14888 Number of successful extensions: 51 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86071221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -