BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J02 (803 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ177378-1|ABA60839.1| 528|Drosophila melanogaster Iris protein. 29 7.4 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 29 9.8 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 29 9.8 AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich pro... 29 9.8 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 29 9.8 >DQ177378-1|ABA60839.1| 528|Drosophila melanogaster Iris protein. Length = 528 Score = 29.1 bits (62), Expect = 7.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 351 VVVQNIYLFLS*SRTKQLINVIVENCVSYHH 259 +++ +YL+L SR K N I E +S HH Sbjct: 168 LIMMKLYLYLMGSRLKSAQNAITEAIISAHH 198 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 28.7 bits (61), Expect = 9.8 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = -2 Query: 487 GDFGATGGDETIVEGGHGGATSTQYGPPGHVAGP 386 GD G TGGD G A S+ YGPPG +GP Sbjct: 258 GDGGFTGGDS-----GSISAPSSNYGPPGK-SGP 285 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 28.7 bits (61), Expect = 9.8 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = -2 Query: 487 GDFGATGGDETIVEGGHGGATSTQYGPPGHVAGP 386 GD G TGGD G A S+ YGPPG +GP Sbjct: 258 GDGGFTGGDS-----GSISAPSSNYGPPGK-SGP 285 >AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich protein protein. Length = 286 Score = 28.7 bits (61), Expect = 9.8 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = -2 Query: 487 GDFGATGGDETIVEGGHGGATSTQYGPPGHVAGP 386 GD G TGGD G A S+ YGPPG +GP Sbjct: 258 GDGGFTGGDS-----GSISAPSSNYGPPGK-SGP 285 >AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA protein. Length = 286 Score = 28.7 bits (61), Expect = 9.8 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = -2 Query: 487 GDFGATGGDETIVEGGHGGATSTQYGPPGHVAGP 386 GD G TGGD G A S+ YGPPG +GP Sbjct: 258 GDGGFTGGDS-----GSISAPSSNYGPPGK-SGP 285 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,724,396 Number of Sequences: 53049 Number of extensions: 495291 Number of successful extensions: 1556 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1553 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3757402116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -