BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J01 (764 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57111| Best HMM Match : Drf_FH1 (HMM E-Value=3.3) 28 7.2 SB_34671| Best HMM Match : GDA1_CD39 (HMM E-Value=6.1e-37) 28 7.2 >SB_57111| Best HMM Match : Drf_FH1 (HMM E-Value=3.3) Length = 451 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -1 Query: 749 GMVGDDPAAYLTN-EAHDAPVGDEIASTAEPD 657 G+ D P ++ EA AP+GD ++ EPD Sbjct: 416 GLAADAPVRPVSEGEAESAPLGDRVSQAEEPD 447 >SB_34671| Best HMM Match : GDA1_CD39 (HMM E-Value=6.1e-37) Length = 400 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 625 MPLAWTECSVASGSAVDAISSPTGAS*ASLVRYAAGSSPT 744 M + W C +A G +D +S+ T ++ V + AGSS T Sbjct: 1 MKVTWLACLLALGLTLDLVSARTISTVKYAVMFDAGSSGT 40 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,299,173 Number of Sequences: 59808 Number of extensions: 309462 Number of successful extensions: 490 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -