BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J01 (764 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L14856-1|AAA36623.1| 388|Homo sapiens somatostatin receptor pro... 31 4.5 L07833-1|AAA60565.1| 388|Homo sapiens somatostatin receptor pro... 31 4.5 D16826-1|BAA04106.1| 388|Homo sapiens fourth somatostatin recep... 31 4.5 BC117272-1|AAI17273.1| 388|Homo sapiens somatostatin receptor 4... 31 4.5 BC117270-1|AAI17271.1| 388|Homo sapiens somatostatin receptor 4... 31 4.5 BC069063-1|AAH69063.1| 388|Homo sapiens somatostatin receptor 4... 31 4.5 AY548169-1|AAS55648.1| 388|Homo sapiens somatostatin receptor 4... 31 4.5 AL049651-1|CAB51953.1| 388|Homo sapiens somatostatin receptor 4... 31 4.5 M81829-1|AAA58247.1| 391|Homo sapiens somatostatin receptor iso... 30 7.9 BC035618-1|AAH35618.1| 391|Homo sapiens somatostatin receptor 1... 30 7.9 AY322536-1|AAP84349.1| 391|Homo sapiens somatostatin receptor 1... 30 7.9 >L14856-1|AAA36623.1| 388|Homo sapiens somatostatin receptor protein. Length = 388 Score = 31.1 bits (67), Expect = 4.5 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = -1 Query: 224 IDNSSIFQHEP*FYVLCNLTIKVHFFGTYHSE*CSKVVFIEVT*LVYHKLKIKNLTGSDL 45 + +S+ +H P VLC + V + S C V+ ++ V H L+ + Sbjct: 103 VASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSV 162 Query: 44 AKLIKFELW 18 AKLI +W Sbjct: 163 AKLINLGVW 171 >L07833-1|AAA60565.1| 388|Homo sapiens somatostatin receptor protein. Length = 388 Score = 31.1 bits (67), Expect = 4.5 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = -1 Query: 224 IDNSSIFQHEP*FYVLCNLTIKVHFFGTYHSE*CSKVVFIEVT*LVYHKLKIKNLTGSDL 45 + +S+ +H P VLC + V + S C V+ ++ V H L+ + Sbjct: 103 VASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSV 162 Query: 44 AKLIKFELW 18 AKLI +W Sbjct: 163 AKLINLGVW 171 >D16826-1|BAA04106.1| 388|Homo sapiens fourth somatostatin receptor subtype protein. Length = 388 Score = 31.1 bits (67), Expect = 4.5 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = -1 Query: 224 IDNSSIFQHEP*FYVLCNLTIKVHFFGTYHSE*CSKVVFIEVT*LVYHKLKIKNLTGSDL 45 + +S+ +H P VLC + V + S C V+ ++ V H L+ + Sbjct: 103 VASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSV 162 Query: 44 AKLIKFELW 18 AKLI +W Sbjct: 163 AKLINLGVW 171 >BC117272-1|AAI17273.1| 388|Homo sapiens somatostatin receptor 4 protein. Length = 388 Score = 31.1 bits (67), Expect = 4.5 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = -1 Query: 224 IDNSSIFQHEP*FYVLCNLTIKVHFFGTYHSE*CSKVVFIEVT*LVYHKLKIKNLTGSDL 45 + +S+ +H P VLC + V + S C V+ ++ V H L+ + Sbjct: 103 VASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSV 162 Query: 44 AKLIKFELW 18 AKLI +W Sbjct: 163 AKLINLGVW 171 >BC117270-1|AAI17271.1| 388|Homo sapiens somatostatin receptor 4 protein. Length = 388 Score = 31.1 bits (67), Expect = 4.5 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = -1 Query: 224 IDNSSIFQHEP*FYVLCNLTIKVHFFGTYHSE*CSKVVFIEVT*LVYHKLKIKNLTGSDL 45 + +S+ +H P VLC + V + S C V+ ++ V H L+ + Sbjct: 103 VASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSV 162 Query: 44 AKLIKFELW 18 AKLI +W Sbjct: 163 AKLINLGVW 171 >BC069063-1|AAH69063.1| 388|Homo sapiens somatostatin receptor 4 protein. Length = 388 Score = 31.1 bits (67), Expect = 4.5 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = -1 Query: 224 IDNSSIFQHEP*FYVLCNLTIKVHFFGTYHSE*CSKVVFIEVT*LVYHKLKIKNLTGSDL 45 + +S+ +H P VLC + V + S C V+ ++ V H L+ + Sbjct: 103 VASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSV 162 Query: 44 AKLIKFELW 18 AKLI +W Sbjct: 163 AKLINLGVW 171 >AY548169-1|AAS55648.1| 388|Homo sapiens somatostatin receptor 4 protein. Length = 388 Score = 31.1 bits (67), Expect = 4.5 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = -1 Query: 224 IDNSSIFQHEP*FYVLCNLTIKVHFFGTYHSE*CSKVVFIEVT*LVYHKLKIKNLTGSDL 45 + +S+ +H P VLC + V + S C V+ ++ V H L+ + Sbjct: 103 VASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSV 162 Query: 44 AKLIKFELW 18 AKLI +W Sbjct: 163 AKLINLGVW 171 >AL049651-1|CAB51953.1| 388|Homo sapiens somatostatin receptor 4 protein. Length = 388 Score = 31.1 bits (67), Expect = 4.5 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = -1 Query: 224 IDNSSIFQHEP*FYVLCNLTIKVHFFGTYHSE*CSKVVFIEVT*LVYHKLKIKNLTGSDL 45 + +S+ +H P VLC + V + S C V+ ++ V H L+ + Sbjct: 103 VASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSV 162 Query: 44 AKLIKFELW 18 AKLI +W Sbjct: 163 AKLINLGVW 171 >M81829-1|AAA58247.1| 391|Homo sapiens somatostatin receptor isoform 1 protein. Length = 391 Score = 30.3 bits (65), Expect = 7.9 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = -1 Query: 215 SSIFQHEP*FYVLCNLTIKVHFFGTYHSE*CSKVVFIEVT*LVYHKLKIKNLTGSDLAKL 36 S++ +H P +LC L + V + S C V+ ++ V H +K +AK+ Sbjct: 117 STLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKV 176 Query: 35 IKFELW 18 + +W Sbjct: 177 VNLGVW 182 >BC035618-1|AAH35618.1| 391|Homo sapiens somatostatin receptor 1 protein. Length = 391 Score = 30.3 bits (65), Expect = 7.9 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = -1 Query: 215 SSIFQHEP*FYVLCNLTIKVHFFGTYHSE*CSKVVFIEVT*LVYHKLKIKNLTGSDLAKL 36 S++ +H P +LC L + V + S C V+ ++ V H +K +AK+ Sbjct: 117 STLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKV 176 Query: 35 IKFELW 18 + +W Sbjct: 177 VNLGVW 182 >AY322536-1|AAP84349.1| 391|Homo sapiens somatostatin receptor 1 protein. Length = 391 Score = 30.3 bits (65), Expect = 7.9 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = -1 Query: 215 SSIFQHEP*FYVLCNLTIKVHFFGTYHSE*CSKVVFIEVT*LVYHKLKIKNLTGSDLAKL 36 S++ +H P +LC L + V + S C V+ ++ V H +K +AK+ Sbjct: 117 STLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKV 176 Query: 35 IKFELW 18 + +W Sbjct: 177 VNLGVW 182 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,297,150 Number of Sequences: 237096 Number of extensions: 1352610 Number of successful extensions: 5583 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 5519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5581 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9199990470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -