BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I22 (796 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 31 0.012 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 27 0.15 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 5.7 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 5.7 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 10.0 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 21 10.0 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 31.1 bits (67), Expect = 0.012 Identities = 31/113 (27%), Positives = 42/113 (37%), Gaps = 6/113 (5%) Frame = -3 Query: 734 LIHPQVVMTGAHIAYKYAPGNLRARAGEWDTPDHXRKCWTTK*DSFEEIIIHEDFNTKSL 555 +I + V+T AH L GE D T S ++IIH ++ Sbjct: 192 IISKRYVLTAAHCIIDENTTKLAIVVGEHDWSSKTETNATVL-HSINKVIIHPKYDIIEK 250 Query: 554 K----NDVALLRMHAPFNLAEHINMICLPDPG--DSFDTSKNCVANGWGKDVF 414 ND+ALL+ + + CLP DSF S V GWG F Sbjct: 251 DDWQINDIALLKTEKDIKFGDKVGPACLPFQHFLDSFAGSDVTVL-GWGHTSF 302 Score = 30.3 bits (65), Expect = 0.022 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -1 Query: 268 EGRDTCQGDGGAPLACP-IGDSRYKLAGLVAWGIGCGQ 158 +G+D CQ D G P+ R G+++WG CG+ Sbjct: 340 KGKDACQMDSGGPVLWQNPRTKRLVNIGIISWGAECGK 377 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 27.5 bits (58), Expect = 0.15 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 168 PMPQATSPANL*RLSPMGQARGAPPSPWQVSLPSCPP 278 P A P SP RG+PP+P Q P PP Sbjct: 16 PSSGAPGPQPSPHQSPQAPQRGSPPNPSQGPPPGGPP 52 Score = 25.4 bits (53), Expect = 0.61 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 5/68 (7%) Frame = +3 Query: 162 PHPMPQAT---SPANL*RLSPMGQARGAPPS--PWQVSLPSCPPAHTKLSCRRNLVPSLV 326 PH PQA SP N + P G GAPPS P Q+ + H + + S Sbjct: 27 PHQSPQAPQRGSPPNPSQGPPPGGPPGAPPSQNPSQMMISPASGIHQMQQLLQQHILSPT 86 Query: 327 RCSSELQR 350 + S +Q+ Sbjct: 87 QLQSFMQQ 94 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 5.7 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -3 Query: 200 QVGRAGRLGHRVRA 159 ++GR GR+G+R RA Sbjct: 538 RIGRTGRVGNRGRA 551 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +2 Query: 212 TYGTGQGGSTVALASVPALLSPGAHETVVQTEP 310 T G +A ++ + SPG + +QT+P Sbjct: 1267 TTGAAVYARVIAPTTITSSQSPGNQQQTIQTQP 1299 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 10.0 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -3 Query: 236 SPPGLSHR*QPLQVGRAGRLGHRVRAE---GRARGLRQRGPHE 117 S PG P + + R+ RV A GR GLR RGP + Sbjct: 394 STPGTGREHDPAKFPPSFRIS-RVAAYNTYGRNAGLRYRGPKQ 435 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.4 bits (43), Expect = 10.0 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 471 PRVREADHVDVLG 509 P V E+D VDV+G Sbjct: 200 PSVSESDEVDVIG 212 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 236,602 Number of Sequences: 438 Number of extensions: 5979 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25125039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -