BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I16 (791 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 270 1e-74 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 25 0.81 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 7.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 7.5 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 9.9 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 270 bits (661), Expect = 1e-74 Identities = 128/133 (96%), Positives = 129/133 (96%) Frame = -1 Query: 776 EMATXASSXSLEKXYELPDXQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 597 EMAT ASS SLEK YELPD QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 596 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSI 417 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE+KYSVWIGGSI Sbjct: 61 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSI 120 Query: 416 LASLSTFQQMWIS 378 LASLSTFQQMWIS Sbjct: 121 LASLSTFQQMWIS 133 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 25.0 bits (52), Expect = 0.81 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = -1 Query: 614 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 435 N +K D DI++ Y + V MYP + M+K I+ + KI I P E K + Sbjct: 342 NKELKYD-DIKEMEYLDKVFKETLRMYPPASILMRKAISDYTFNDTKITI--PKEMK--I 396 Query: 434 WI 429 WI Sbjct: 397 WI 398 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 7.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 561 RIVRWYHHVPWNRRPYAK 508 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 7.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 561 RIVRWYHHVPWNRRPYAK 508 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 9.9 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -1 Query: 665 QPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 555 + +FLG+ + +YN + D + KDL+ +L Sbjct: 328 ETTFLGLIRLIVLNLSYNMLTHIDARMFKDLFFLQIL 364 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,773 Number of Sequences: 438 Number of extensions: 4502 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -