BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I14 (818 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1805.15c |pub2||ubiquitin-protein ligase Pub2|Schizosaccharo... 26 7.4 SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyc... 25 9.8 >SPAC1805.15c |pub2||ubiquitin-protein ligase Pub2|Schizosaccharomyces pombe|chr 1|||Manual Length = 671 Score = 25.8 bits (54), Expect = 7.4 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -1 Query: 527 HSGLEPLTPWMIDLLAHHCIMNNPQRQALPINVAFR 420 H LE LTP + + + NN + +L IN+ ++ Sbjct: 183 HEKLENLTPKQLKEVFSQFLFNNQSKSSLKINLEYK 218 >SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyces pombe|chr 1|||Manual Length = 354 Score = 25.4 bits (53), Expect = 9.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 Query: 359 GPAAPRSPAGTTRPPSE 409 G A+P +PA TRPP E Sbjct: 296 GAASPPAPAQDTRPPEE 312 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,302,200 Number of Sequences: 5004 Number of extensions: 39263 Number of successful extensions: 115 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 400438000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -