BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I04 (785 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 23 3.2 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 23 3.2 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 23 3.2 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 23 3.2 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 23 3.2 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 23 3.2 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 23 3.2 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 23 3.2 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 9.8 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 23.0 bits (47), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 422 LSHDDVIRRYNERGQP-TGDARVAFRTPFDATR 327 L DD IR N P +G R AF TP R Sbjct: 346 LDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 23.0 bits (47), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 422 LSHDDVIRRYNERGQP-TGDARVAFRTPFDATR 327 L DD IR N P +G R AF TP R Sbjct: 346 LDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 23.0 bits (47), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 422 LSHDDVIRRYNERGQP-TGDARVAFRTPFDATR 327 L DD IR N P +G R AF TP R Sbjct: 346 LDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 23.0 bits (47), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 422 LSHDDVIRRYNERGQP-TGDARVAFRTPFDATR 327 L DD IR N P +G R AF TP R Sbjct: 346 LDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 23.0 bits (47), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 422 LSHDDVIRRYNERGQP-TGDARVAFRTPFDATR 327 L DD IR N P +G R AF TP R Sbjct: 346 LDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 23.0 bits (47), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 422 LSHDDVIRRYNERGQP-TGDARVAFRTPFDATR 327 L DD IR N P +G R AF TP R Sbjct: 346 LDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.0 bits (47), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 422 LSHDDVIRRYNERGQP-TGDARVAFRTPFDATR 327 L DD IR N P +G R AF TP R Sbjct: 414 LDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 446 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.0 bits (47), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 422 LSHDDVIRRYNERGQP-TGDARVAFRTPFDATR 327 L DD IR N P +G R AF TP R Sbjct: 414 LDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 446 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/35 (25%), Positives = 15/35 (42%) Frame = +1 Query: 430 SEKNCRISSMVARNGTFSMETTQPGAPKSCSAGSW 534 S NC +SS+ A + + P + G+W Sbjct: 70 SVTNCFVSSLAAADLLVGLAVMPPAVLLQLTGGTW 104 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,354 Number of Sequences: 438 Number of extensions: 2216 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -