BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I03 (796 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0832 - 28037047-28037315,28037428-28037530,28037664-280376... 29 5.6 06_03_1175 + 28168007-28170058 28 9.8 >03_05_0832 - 28037047-28037315,28037428-28037530,28037664-28037695, 28037788-28038005,28038145-28038260,28038514-28038757, 28039129-28039216,28039513-28039588,28040126-28040164, 28040347-28040405,28041292-28041529 Length = 493 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 259 YTVPWGFNGFINYIK 303 Y VPWG G +NYIK Sbjct: 377 YIVPWGMYGCVNYIK 391 >06_03_1175 + 28168007-28170058 Length = 683 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = -1 Query: 739 SPVAGPPCIGFRSTLPLLYXTFVPCSFSHISRPVQPCCCGCSASRD 602 SPV P G S+ P + V C+ + R CC SA D Sbjct: 396 SPVVFPDQTGLMSSTPAVASWQVACNITRPKRRAAKCCVSFSAYYD 441 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,270,432 Number of Sequences: 37544 Number of extensions: 403219 Number of successful extensions: 826 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2150667972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -