BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I01 (776 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 24 1.8 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 7.3 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 7.3 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -2 Query: 214 CILYFILNIIFLVNTML*FGLCILSCTVA 128 CIL+F++ ++F+ + GL I S ++A Sbjct: 210 CILFFLIPMVFIAVLYIRIGLRIQSDSLA 238 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 7.3 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +2 Query: 143 QNAQAKLKHRIY*KNYIQNKIQYTSNDLDELLFLGM 250 ++ Q +L++R+Y + +K S D D + LG+ Sbjct: 202 ESEQHRLQNRLYTNDSTSSKTDDDSIDFDRMNSLGL 237 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 7.3 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +2 Query: 143 QNAQAKLKHRIY*KNYIQNKIQYTSNDLDELLFLGM 250 ++ Q +L++R+Y + +K S D D + LG+ Sbjct: 240 ESEQHRLQNRLYTNDSTSSKTDDDSIDFDRMNSLGL 275 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,526 Number of Sequences: 438 Number of extensions: 3672 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -