BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_H19 (808 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0479 + 3606663-3607448 29 3.3 05_04_0011 + 17139322-17139451,17139552-17140174 29 5.8 >07_01_0479 + 3606663-3607448 Length = 261 Score = 29.5 bits (63), Expect = 3.3 Identities = 24/81 (29%), Positives = 25/81 (30%), Gaps = 3/81 (3%) Frame = +1 Query: 355 PXFFFXPPXXPPXFFXXXKXGGPKXPXXXXX--PPPGGXP-TXGXXXGXXXKXFKXXXSP 525 P F PP PP F GGP P PPP G P G + P Sbjct: 184 PIPFQRPPGVPPAF-----PGGPPPPPGPFMRGPPPMGPPQVRPGMPGGPPPGMRPGMPP 238 Query: 526 PXXXLLKXPPPKXTSXPXGGP 588 P PPP P P Sbjct: 239 PPFRPGMPPPPPGPQQPGQNP 259 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +1 Query: 448 PPPGGXPTXGXXXGXXXKXFKXXXSPPXXXLLKXPPPKXTSXPXGG 585 PPP P G G + P PPP S P GG Sbjct: 71 PPPPSPPNGGNVIGNGKRLTPTGPDPIHNEFQPPPPPPPPSPPNGG 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,361,941 Number of Sequences: 37544 Number of extensions: 146186 Number of successful extensions: 116 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2197677108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -