BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_H16 (875 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 24 1.4 DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 22 7.3 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 24.2 bits (50), Expect = 1.4 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -1 Query: 224 SIQFSCIESIILAHY-ETTSVFCMYLIV 144 SIQ CIES +++ Y E T F +L V Sbjct: 74 SIQIRCIESNMISFYLEATDDFAYFLEV 101 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 21.8 bits (44), Expect = 7.3 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 9/54 (16%) Frame = -2 Query: 427 CVYLLYECSEWACAT-----NLTESRSD---RVSAVAHARVS-ETCAWFCKKNV 293 CVY + E SE C T NL + D R+ + + V+ C CK V Sbjct: 14 CVYSVSEISEETCETLMSDINLIKEEFDELGRLQRICNGEVAVNKCEGSCKSQV 67 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,095 Number of Sequences: 336 Number of extensions: 2981 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24203322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -