BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_H02 (770 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016448-12|AAB65959.1| 316|Caenorhabditis elegans Hypothetical... 29 2.8 AF003142-3|AAB54188.1| 739|Caenorhabditis elegans Him-three par... 29 3.7 >AF016448-12|AAB65959.1| 316|Caenorhabditis elegans Hypothetical protein F41E6.11 protein. Length = 316 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 486 PYPVYKEVQVPLVKEVPYPVKYHVPI 409 P PV + V VP+ +VP P++ VP+ Sbjct: 149 PQPVIQHVPVPVPVQVPVPIRVPVPV 174 >AF003142-3|AAB54188.1| 739|Caenorhabditis elegans Him-three paralog protein 3 protein. Length = 739 Score = 29.1 bits (62), Expect = 3.7 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 4/63 (6%) Frame = -1 Query: 641 RSPLTSPTRSK*RSPIRSPLKCQYQNLTKS----SRKSLTPSKRKCLMKSKCLLTSPTRS 474 R+P T ++ SP+ SP+K Q Q K+ S K T + +C K + + +P R Sbjct: 350 RAPAVPITPTEPASPVESPVKEQPQKAPKAQMRRSSKRTTKNNERCEQKEEEPIVNPKRR 409 Query: 473 TRK 465 + + Sbjct: 410 SAR 412 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,678,421 Number of Sequences: 27780 Number of extensions: 237728 Number of successful extensions: 749 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1851132448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -